(data stored in ACNUC7421 zone)

EMBL: CP000820.PE401

CP000820.PE401       Location/Qualifiers
FT   CDS             complement(482764..483234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0404"
FT                   /product="67-dimethyl-8-ribityllumazine synthase"
FT                   /note="PFAM: 67-dimethyl-8-ribityllumazine synthase; KEGG:
FT                   nfa:nfa16640 putative riboflavin synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09870"
FT                   /db_xref="GOA:A8LGD1"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD1"
FT                   /protein_id="ABW09870.1"
FT                   /translation="MPSTPTGARPDTVRVAIVAARWHADIVGQAVASFRSALAERGVGE
FT                   VDEYQVPGAFEIPLHTRRLALTGRYDAIATCAFVVDGGIYRHDFVAGTVVDALMRVQLD
FT                   TDVPVFSAVLTPQAFHEHAEHQEFFARHFQVKGRELADAVVTTIAGLAALPA"
     MPSTPTGARP DTVRVAIVAA RWHADIVGQA VASFRSALAE RGVGEVDEYQ VPGAFEIPLH        60
     TRRLALTGRY DAIATCAFVV DGGIYRHDFV AGTVVDALMR VQLDTDVPVF SAVLTPQAFH       120
     EHAEHQEFFA RHFQVKGREL ADAVVTTIAG LAALPA                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page