(data stored in ACNUC7421 zone)

EMBL: CP000820.PE403

CP000820.PE403       Location/Qualifiers
FT   CDS             484418..485326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0406"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; KEGG: rle:RL2719
FT                   putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09872"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD3"
FT                   /protein_id="ABW09872.1"
FT                   /translation="MTTTLPAAGRLTTDEPAARRYAATVAVHRELPPAKLAPALAEIAR
FT                   GVRRDIVTTIGQAGMGHLGGDLSVTDILVAAYWRALTVDPFAPDAADRDRFVLSKGHCA
FT                   VALYSVLASCGFFPRSALETFGGPLSPLNGHPNRVKVPGVETNTGPLGHGLPVAVGCAL
FT                   GARLRGIANRTIVVLGDGEIQEGSNWEAAMTAAYHRLATLVAVVDRNRLQQGARTEETK
FT                   ALEPLDAKWAAFGWEVRRIDGHDHQALVEALAPSSTGRPVAVLADTVKGKGVSFVEDRV
FT                   EWHHKVPSAEQLRAALEELSG"
     MTTTLPAAGR LTTDEPAARR YAATVAVHRE LPPAKLAPAL AEIARGVRRD IVTTIGQAGM        60
     GHLGGDLSVT DILVAAYWRA LTVDPFAPDA ADRDRFVLSK GHCAVALYSV LASCGFFPRS       120
     ALETFGGPLS PLNGHPNRVK VPGVETNTGP LGHGLPVAVG CALGARLRGI ANRTIVVLGD       180
     GEIQEGSNWE AAMTAAYHRL ATLVAVVDRN RLQQGARTEE TKALEPLDAK WAAFGWEVRR       240
     IDGHDHQALV EALAPSSTGR PVAVLADTVK GKGVSFVEDR VEWHHKVPSA EQLRAALEEL       300
     SG                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page