(data stored in ACNUC7421 zone)

EMBL: CP000820.PE404

CP000820.PE404       Location/Qualifiers
FT   CDS             485352..486323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0407"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: rle:RL2718 putative transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09873"
FT                   /db_xref="GOA:A8LGD4"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD4"
FT                   /protein_id="ABW09873.1"
FT                   /translation="MSTVAPPGVDAPTFDCRVDFAAELAALARVDERIVAVCNDSVGSS
FT                   NLGAFRDEFPDRLINVGIAEQDLVGVGAGLANAGMVPFVCAAAPFLTGRATEQIKADVA
FT                   YSERHVVLCGHSPGMAYGELGPTHHSIEDLAWMRAVAGLTIAVPADPAQTRAAVLWAAG
FT                   YGRPVYLRIPRFKVPEVSRQGDPFLPGRAVLLREGSDVTLAAVGSMVSRAIWAAQILAD
FT                   DGISARVLNMTFVEPIDRDALISAAEQTAGIVTVEEATTSGGLGAAVAAVVGQTRPCPL
FT                   RILGVPRQFAPTGSTQFLLDHFGLNADGIVGAAREVVGGTRA"
     MSTVAPPGVD APTFDCRVDF AAELAALARV DERIVAVCND SVGSSNLGAF RDEFPDRLIN        60
     VGIAEQDLVG VGAGLANAGM VPFVCAAAPF LTGRATEQIK ADVAYSERHV VLCGHSPGMA       120
     YGELGPTHHS IEDLAWMRAV AGLTIAVPAD PAQTRAAVLW AAGYGRPVYL RIPRFKVPEV       180
     SRQGDPFLPG RAVLLREGSD VTLAAVGSMV SRAIWAAQIL ADDGISARVL NMTFVEPIDR       240
     DALISAAEQT AGIVTVEEAT TSGGLGAAVA AVVGQTRPCP LRILGVPRQF APTGSTQFLL       300
     DHFGLNADGI VGAAREVVGG TRA                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page