(data stored in ACNUC7421 zone)

EMBL: CP000820.PE41

CP000820.PE41        Location/Qualifiers
FT   CDS             49995..50705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0042"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; KEGG: psa:PST_0242 probable
FT                   DNA invertase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09510"
FT                   /db_xref="GOA:A8LB49"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB49"
FT                   /protein_id="ABW09510.1"
FT                   /translation="MAVPDDRGPGRPWTPRPPTAPVPAPASPATAIRIGYARCSAAQQD
FT                   LASQLEALRAAHCKRIFSEKISTRIKVRPELEAALRLARDIKQAAPDQPMILTVPELKR
FT                   LARNAAELMTPSTTLQADGVQLELLTGPLTGIYDPHGMSSMLFAILAVAAQLDRNYIRE
FT                   KTLEGQQTAAARGNHGGRPRVIDDDMLVFARALKDRGIPMPEIARKLTHCCRKTNTDDR
FT                   ASGFPKTHQVPGPA"
     MAVPDDRGPG RPWTPRPPTA PVPAPASPAT AIRIGYARCS AAQQDLASQL EALRAAHCKR        60
     IFSEKISTRI KVRPELEAAL RLARDIKQAA PDQPMILTVP ELKRLARNAA ELMTPSTTLQ       120
     ADGVQLELLT GPLTGIYDPH GMSSMLFAIL AVAAQLDRNY IREKTLEGQQ TAAARGNHGG       180
     RPRVIDDDML VFARALKDRG IPMPEIARKL THCCRKTNTD DRASGFPKTH QVPGPA           236
//

If you have problems or comments...

PBIL Back to PBIL home page