(data stored in ACNUC7421 zone)

EMBL: CP000820.PE412

CP000820.PE412       Location/Qualifiers
FT   CDS             492137..492259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09881"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE2"
FT                   /protein_id="ABW09881.1"
FT                   /translation="MKRIGRPEATAGVCVFPASEAASYINGAQVLADGGLFRTL"
     MKRIGRPEAT AGVCVFPASE AASYINGAQV LADGGLFRTL                              40
//

If you have problems or comments...

PBIL Back to PBIL home page