(data stored in ACNUC7421 zone)

EMBL: CP000820.PE418

CP000820.PE418       Location/Qualifiers
FT   CDS             complement(496928..497878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0422"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mva:Mvan_5938
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09887"
FT                   /db_xref="GOA:A8LGE8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE8"
FT                   /protein_id="ABW09887.1"
FT                   /translation="MAGSRPVSGLRARAEEYLAMRRALGFKLESHGPRLMSFVRFCDER
FT                   DATTVTTDLAVEWATSTGSDHEAYQARRLDVVRIFARHLQPLDPATEVPPADVLDRRQW
FT                   RIPPYLYSPQEVTALMSAAGRLRPAIRAATWRTLIGLLAVTGMRQGEACRLGRDDVDLN
FT                   AETIVIEDSKFGKSRVVFLHPTAAAALRVYTRARDAAFLQAEAGTFFVNSLGRPLDSRN
FT                   TPTTFAGLVTAAGIKAPPGQRAPRLHDLRHVFTVATLLDWYRDGGDVQARLPALSTWLG
FT                   HIDPKSTYWYLSAVPELLALAAVRLEPAGQEQTAS"
     MAGSRPVSGL RARAEEYLAM RRALGFKLES HGPRLMSFVR FCDERDATTV TTDLAVEWAT        60
     STGSDHEAYQ ARRLDVVRIF ARHLQPLDPA TEVPPADVLD RRQWRIPPYL YSPQEVTALM       120
     SAAGRLRPAI RAATWRTLIG LLAVTGMRQG EACRLGRDDV DLNAETIVIE DSKFGKSRVV       180
     FLHPTAAAAL RVYTRARDAA FLQAEAGTFF VNSLGRPLDS RNTPTTFAGL VTAAGIKAPP       240
     GQRAPRLHDL RHVFTVATLL DWYRDGGDVQ ARLPALSTWL GHIDPKSTYW YLSAVPELLA       300
     LAAVRLEPAG QEQTAS                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page