(data stored in ACNUC7421 zone)

EMBL: CP000820.PE42

CP000820.PE42        Location/Qualifiers
FT   CDS             51034..56460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpc:LPC_2635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09511"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB50"
FT                   /protein_id="ABW09511.1"
FT                   /translation="MESVIGKVHGPDGSSFVGHSVRLRYTVDLGDRDATPPTALPVRLE
FT                   SAAPLAADGDFALAIADAPLVGTATVTIVSPAGVTINEGTLSVDALANPVIVSATPAAP
FT                   LPVLPNHEPGTGPRVRLTGRVIDDRGHRVSSGLPVVISGRRVDQNGDPEIADRVLLVTD
FT                   TQPGGTFGADWPTDELATAHGVVKGLPPVPIPLVGGRLPLKVLLVVSLPDDEREDCACD
FT                   NTAPRAPDPSDLTSNPAAFSQDMGGTCVDLTTPNRVVEEFAYFFVVRTSEPEIRGTTLG
FT                   TRRVLPPAVTRELLGAVREALPAAEGASTRAIRGLSLDTAALKSLVATDAIPSVDQLQV
FT                   AAYHSEVAAVSRLVDALRRRQPGRVALDASSAVDWDDTPTIYQAASVAHGHILQYREVW
FT                   RADGYSLGDLLYSLPLAPGQKRKLAVLDWERQTTSARTERLDFEEQLDAFAERDRDISE
FT                   IVGSHLNEESSGGSRSNTWGVAGGIGAGFIGSGFGIFGGVAGGAGGSSARAWQDNARDL
FT                   SANSLQQLRDRMVQRSAAVRDVRSTTVQTVGQGETVRAETETVANYNHCHAMTVEYFNV
FT                   LRHFLVTHELADVRECLFVPLPISEFDRAKAMRWRSALQRFVSDPTLRRGFDAIERISR
FT                   NWVGYDFPVDRYSEEAPESLEGELYVSFLLPRPRDAADGTFQVDMWKSCQWLLPIDALE
FT                   LFTAKLAARAQRERDLVFRNEIAPGIAEQLVQHLRFAYVTASGAQLGVRLDPTLVSRYA
FT                   ESTPLYVTLRPSGAVPAIPREDIARFRIWYDGPALPSAARVIVHRGKVRYRTEHLQYLL
FT                   FDEPRLLNDISSTDDIYVATPLSRAELRSPRREDIEAADRLVKHLNTNIERAHQAIWAS
FT                   MDENRRYLLLDGVIAPNSGGRSVASVVENRLIGIVGNCLVMPCGPGIQLDPSRAVPQAR
FT                   TDGEPVEPQPLIDLYATAPLPSTRISLPTRGVYAEAVSGECNACERIDDTRFWRWEESA
FT                   ITDTPPDIAALSTASRASDEPDLTPTPLPAAIVNIQQPASLPDPLGLSAAMKVLARNDL
FT                   FKDITGLEGSQKNALAGFKAALGMAQTLGGEAANLARQNESARNADRLMDSIQQAQRDK
FT                   LISPDQAQQLTQSVLRSASGEASAKDRPAAPAEDPGVQKAIDSAADSPRATVSVTTPTE
FT                   SLDATFDGGPKPPVIGGAPAIGGTTLTFDLAIPFIDDWTQPAPGTPPGPLTRQRWTETR
FT                   KIAKLSTASSVTQRTGPTSFSRFDLAAAALSNGLIKREAPGSDTFVVPTKMRLAHPAPS
FT                   AGSKVVAGSGALPLVVFLHGNHQAWDFTFGPPTSTMTALDGAGNPVTVDIVDTTTAFTV
FT                   TPNHEGYAYLQDSLAASGYASISIDTNFANTFNSAIDTRALTVLAALDRLRTAAETKGN
FT                   AYFGRFDFHKVVLVGHSRGGDAVVQVARLNAKRVTKKYGVLAVCSLAPTDFSGTAAAGD
FT                   GPFVLTPNETGFFLAIQAALDGDVSGVGGATAGTGTVFRHYARATCQKALVQLTKCCHN
FT                   RFNTVWSKEPIDRAHDDSALVDAEFNALHTHATHRQLFTEYLTALLEKQVRKNSKDVAL
FT                   FTGQRSNSAGVDAAHQWAFGRTVTLMDSFEAAASDLGGARTLTAAAVGPFLDVKVPEST
FT                   LKRGGNAGTLVAITEHATHVTKLANLDTAVVASGTAFTIDVPSAKRDWSGFEVVNLDVV
FT                   GTFDLTKASSQPVPVLTVTLTDGSGTTKQLTARNVLNQPSTHIVNYDRAVPKDPTKEQD
FT                   ATLFRLETLSFELPRTSTVGGIDSGDIVSLTVDVDLSVGNTVLIDSITLVAL"
     MESVIGKVHG PDGSSFVGHS VRLRYTVDLG DRDATPPTAL PVRLESAAPL AADGDFALAI        60
     ADAPLVGTAT VTIVSPAGVT INEGTLSVDA LANPVIVSAT PAAPLPVLPN HEPGTGPRVR       120
     LTGRVIDDRG HRVSSGLPVV ISGRRVDQNG DPEIADRVLL VTDTQPGGTF GADWPTDELA       180
     TAHGVVKGLP PVPIPLVGGR LPLKVLLVVS LPDDEREDCA CDNTAPRAPD PSDLTSNPAA       240
     FSQDMGGTCV DLTTPNRVVE EFAYFFVVRT SEPEIRGTTL GTRRVLPPAV TRELLGAVRE       300
     ALPAAEGAST RAIRGLSLDT AALKSLVATD AIPSVDQLQV AAYHSEVAAV SRLVDALRRR       360
     QPGRVALDAS SAVDWDDTPT IYQAASVAHG HILQYREVWR ADGYSLGDLL YSLPLAPGQK       420
     RKLAVLDWER QTTSARTERL DFEEQLDAFA ERDRDISEIV GSHLNEESSG GSRSNTWGVA       480
     GGIGAGFIGS GFGIFGGVAG GAGGSSARAW QDNARDLSAN SLQQLRDRMV QRSAAVRDVR       540
     STTVQTVGQG ETVRAETETV ANYNHCHAMT VEYFNVLRHF LVTHELADVR ECLFVPLPIS       600
     EFDRAKAMRW RSALQRFVSD PTLRRGFDAI ERISRNWVGY DFPVDRYSEE APESLEGELY       660
     VSFLLPRPRD AADGTFQVDM WKSCQWLLPI DALELFTAKL AARAQRERDL VFRNEIAPGI       720
     AEQLVQHLRF AYVTASGAQL GVRLDPTLVS RYAESTPLYV TLRPSGAVPA IPREDIARFR       780
     IWYDGPALPS AARVIVHRGK VRYRTEHLQY LLFDEPRLLN DISSTDDIYV ATPLSRAELR       840
     SPRREDIEAA DRLVKHLNTN IERAHQAIWA SMDENRRYLL LDGVIAPNSG GRSVASVVEN       900
     RLIGIVGNCL VMPCGPGIQL DPSRAVPQAR TDGEPVEPQP LIDLYATAPL PSTRISLPTR       960
     GVYAEAVSGE CNACERIDDT RFWRWEESAI TDTPPDIAAL STASRASDEP DLTPTPLPAA      1020
     IVNIQQPASL PDPLGLSAAM KVLARNDLFK DITGLEGSQK NALAGFKAAL GMAQTLGGEA      1080
     ANLARQNESA RNADRLMDSI QQAQRDKLIS PDQAQQLTQS VLRSASGEAS AKDRPAAPAE      1140
     DPGVQKAIDS AADSPRATVS VTTPTESLDA TFDGGPKPPV IGGAPAIGGT TLTFDLAIPF      1200
     IDDWTQPAPG TPPGPLTRQR WTETRKIAKL STASSVTQRT GPTSFSRFDL AAAALSNGLI      1260
     KREAPGSDTF VVPTKMRLAH PAPSAGSKVV AGSGALPLVV FLHGNHQAWD FTFGPPTSTM      1320
     TALDGAGNPV TVDIVDTTTA FTVTPNHEGY AYLQDSLAAS GYASISIDTN FANTFNSAID      1380
     TRALTVLAAL DRLRTAAETK GNAYFGRFDF HKVVLVGHSR GGDAVVQVAR LNAKRVTKKY      1440
     GVLAVCSLAP TDFSGTAAAG DGPFVLTPNE TGFFLAIQAA LDGDVSGVGG ATAGTGTVFR      1500
     HYARATCQKA LVQLTKCCHN RFNTVWSKEP IDRAHDDSAL VDAEFNALHT HATHRQLFTE      1560
     YLTALLEKQV RKNSKDVALF TGQRSNSAGV DAAHQWAFGR TVTLMDSFEA AASDLGGART      1620
     LTAAAVGPFL DVKVPESTLK RGGNAGTLVA ITEHATHVTK LANLDTAVVA SGTAFTIDVP      1680
     SAKRDWSGFE VVNLDVVGTF DLTKASSQPV PVLTVTLTDG SGTTKQLTAR NVLNQPSTHI      1740
     VNYDRAVPKD PTKEQDATLF RLETLSFELP RTSTVGGIDS GDIVSLTVDV DLSVGNTVLI      1800
     DSITLVAL                                                               1808
//

If you have problems or comments...

PBIL Back to PBIL home page