(data stored in ACNUC7421 zone)

EMBL: CP000820.PE420

CP000820.PE420       Location/Qualifiers
FT   CDS             498987..499841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_2660 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09889"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF0"
FT                   /protein_id="ABW09889.1"
FT                   /translation="MRQFLRDDLRLELSAEKTLITHAQTGRARFLGYDIVAQHSDTKIT
FT                   RGRRAVNGAIGLRVPPEVIRNNRGFYSWAAWDTASATGAGLLWRAPTGLDLPVVRVLPD
FT                   GTFLTALITPTIRGARRERLLGAARTGLDLDDINTVPDAFNERGLPVIHLARVIEYDVP
FT                   DRVGNGTGELIVLLSTITDPAGARADELAAAYNERWEKETANDQLKTHLRGPGRVLRSR
FT                   LPDLAYQEIWSYLIVHHAISALTAKASAAADLDPDSISFAKALRLIRRTATGTADIPPS
FT                   GLD"
     MRQFLRDDLR LELSAEKTLI THAQTGRARF LGYDIVAQHS DTKITRGRRA VNGAIGLRVP        60
     PEVIRNNRGF YSWAAWDTAS ATGAGLLWRA PTGLDLPVVR VLPDGTFLTA LITPTIRGAR       120
     RERLLGAART GLDLDDINTV PDAFNERGLP VIHLARVIEY DVPDRVGNGT GELIVLLSTI       180
     TDPAGARADE LAAAYNERWE KETANDQLKT HLRGPGRVLR SRLPDLAYQE IWSYLIVHHA       240
     ISALTAKASA AADLDPDSIS FAKALRLIRR TATGTADIPP SGLD                        284
//

If you have problems or comments...

PBIL Back to PBIL home page