(data stored in ACNUC7421 zone)

EMBL: CP000820.PE421

CP000820.PE421       Location/Qualifiers
FT   CDS             complement(500080..501174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0425"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: sen:SACE_3275
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09890"
FT                   /db_xref="GOA:A8LGF1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF1"
FT                   /protein_id="ABW09890.1"
FT                   /translation="MHNARIVSTLRDVTDPEGTERTTIQDVAAAAGVSVSAVSKVLRGA
FT                   YGVSPQMRTRVTAAIDRLGYRPHTGARAMRGRTYTVGVVLVELTSPFQTEVAKGISDAL
FT                   EDTSYQDILVTAGATPERQKSRIEALLDRHVDGLVLIAPWIEVAWIEKIAQALPVVAVA
FT                   LHGTPRNFDTVVDDERLGAQLMVDHLVAAGHRQIAHTSAPRAAFEDTFVLSHTARRQGY
FT                   EQAMRGHGLRPDVIETWLSEEGGHQAAQQAFDRARPPTAIFAGADIAAFGVLRAAEERG
FT                   LRVPEDVSVAGYDNIYTSTINRVSLTTVDQSGHGTGAESIRLLLERIEGRAQPRQFVVS
FT                   PHLVTRRTTTAPSGTGISNRGRTV"
     MHNARIVSTL RDVTDPEGTE RTTIQDVAAA AGVSVSAVSK VLRGAYGVSP QMRTRVTAAI        60
     DRLGYRPHTG ARAMRGRTYT VGVVLVELTS PFQTEVAKGI SDALEDTSYQ DILVTAGATP       120
     ERQKSRIEAL LDRHVDGLVL IAPWIEVAWI EKIAQALPVV AVALHGTPRN FDTVVDDERL       180
     GAQLMVDHLV AAGHRQIAHT SAPRAAFEDT FVLSHTARRQ GYEQAMRGHG LRPDVIETWL       240
     SEEGGHQAAQ QAFDRARPPT AIFAGADIAA FGVLRAAEER GLRVPEDVSV AGYDNIYTST       300
     INRVSLTTVD QSGHGTGAES IRLLLERIEG RAQPRQFVVS PHLVTRRTTT APSGTGISNR       360
     GRTV                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page