(data stored in ACNUC7421 zone)

EMBL: CP000820.PE423

CP000820.PE423       Location/Qualifiers
FT   CDS             502903..503844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0427"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rru:Rru_A0980
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09892"
FT                   /db_xref="GOA:A8LGF3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF3"
FT                   /protein_id="ABW09892.1"
FT                   /translation="MMLTLLKNLARSLAVLLVVTFATFTLMFGNGDGIARAVLGLNARP
FT                   EDVQREVVTLGLDQPLLVQYWHWLRDAVTGDLGESFYTGQSVTEALSSRVPVTLALVII
FT                   TLLLAVVLSVLLGVTAAVKGGWVDRLLQFVTVLGTAIPSFIIAIVLVFTFAIAWRVLPA
FT                   TGYVTPEISVSGWAKSVTLPVLALLVGAVASAAAQFRTAVLDTLGRDYIRTLRARGISE
FT                   RHVIFRHVLRNSAGPGLTVLSLTTLGLLGGAVFVEQVFALPGMGQLANQSAQVNDVPMV
FT                   MGTVLVTIVIVLVVNFLGDLATTVLNPKARIR"
     MMLTLLKNLA RSLAVLLVVT FATFTLMFGN GDGIARAVLG LNARPEDVQR EVVTLGLDQP        60
     LLVQYWHWLR DAVTGDLGES FYTGQSVTEA LSSRVPVTLA LVIITLLLAV VLSVLLGVTA       120
     AVKGGWVDRL LQFVTVLGTA IPSFIIAIVL VFTFAIAWRV LPATGYVTPE ISVSGWAKSV       180
     TLPVLALLVG AVASAAAQFR TAVLDTLGRD YIRTLRARGI SERHVIFRHV LRNSAGPGLT       240
     VLSLTTLGLL GGAVFVEQVF ALPGMGQLAN QSAQVNDVPM VMGTVLVTIV IVLVVNFLGD       300
     LATTVLNPKA RIR                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page