(data stored in ACNUC7421 zone)

EMBL: CP000820.PE424

CP000820.PE424       Location/Qualifiers
FT   CDS             503841..505589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0428"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; ABC transporter related; SMART:
FT                   AAA ATPase; KEGG: sit:TM1040_2684 oligopeptide/dipeptide
FT                   ABC transporter, ATP-binding protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09893"
FT                   /db_xref="GOA:A8LGF4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF4"
FT                   /protein_id="ABW09893.1"
FT                   /translation="MTAERVVGDTRRRVFRQLLRNPQGAVCLAFLAPVVLVAVTSQWLA
FT                   PYSPTETDLDATNAAPFSDGHLLGGDSAGRDILSRLMWGSRQTVLACAIILVISLAVGV
FT                   TSGLVAGFYRGRFEVAAGFVSDVVMSLPGIVLLIALYALTGPNIPAAMAVFGLLIAPTY
FT                   YRLVRNVVLGVRNELYVDAARVAGLSDLRIVGRHVLWAVRAPVIIQSSFVLAAGIGIEA
FT                   GVSFLGLGDPAGASWGIVLQNSFNGIYNNRWAVVWPALLISLTILALVLLGNALSDVLQ
FT                   SSARSKTLSLRARRAAVTAAQQVEPTEDSILVGSSNDVVLSVRGLRVAYPMAGGEIREV
FT                   VHGADLDVRRGEIHGLVGESGSGKSQIAFATLGLLPREALVLGGSVLLDGEDLLADVAK
FT                   MRAARGRRIAYVPQEPMSNLDPSFTIGKQLTYGLRAVTTLDAKQARERIIKLLVRVGIT
FT                   DPEWVMGLYPHEISGGMAQRVLICGAVAADPDVIVADEPTTALDVTVQAEVLELLRELS
FT                   QERGLAMILVTHNLGVVADLCDTVSVMKEGNIVERADVDAIFESPQQAYTRELLSSSRS
FT                   VELMEI"
     MTAERVVGDT RRRVFRQLLR NPQGAVCLAF LAPVVLVAVT SQWLAPYSPT ETDLDATNAA        60
     PFSDGHLLGG DSAGRDILSR LMWGSRQTVL ACAIILVISL AVGVTSGLVA GFYRGRFEVA       120
     AGFVSDVVMS LPGIVLLIAL YALTGPNIPA AMAVFGLLIA PTYYRLVRNV VLGVRNELYV       180
     DAARVAGLSD LRIVGRHVLW AVRAPVIIQS SFVLAAGIGI EAGVSFLGLG DPAGASWGIV       240
     LQNSFNGIYN NRWAVVWPAL LISLTILALV LLGNALSDVL QSSARSKTLS LRARRAAVTA       300
     AQQVEPTEDS ILVGSSNDVV LSVRGLRVAY PMAGGEIREV VHGADLDVRR GEIHGLVGES       360
     GSGKSQIAFA TLGLLPREAL VLGGSVLLDG EDLLADVAKM RAARGRRIAY VPQEPMSNLD       420
     PSFTIGKQLT YGLRAVTTLD AKQARERIIK LLVRVGITDP EWVMGLYPHE ISGGMAQRVL       480
     ICGAVAADPD VIVADEPTTA LDVTVQAEVL ELLRELSQER GLAMILVTHN LGVVADLCDT       540
     VSVMKEGNIV ERADVDAIFE SPQQAYTREL LSSSRSVELM EI                          582
//

If you have problems or comments...

PBIL Back to PBIL home page