(data stored in ACNUC7421 zone)

EMBL: CP000820.PE425

CP000820.PE425       Location/Qualifiers
FT   CDS             505591..506400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0429"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bam:Bamb_3570 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09894"
FT                   /db_xref="GOA:A8LGF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF5"
FT                   /protein_id="ABW09894.1"
FT                   /translation="MTDQPLLRVRDLVVRFAGRRRTSTTVIHGVSFDLAAGETLSLVGE
FT                   SGSGKTTIGRAILGLAPVSEGTVEFRSEIISNVPRARRRELARDVQVVFQDPYSSLNPS
FT                   MTVGDILVEPLTTAGVEGGRTRVKELLDAVGLPADAANRYPREFSGGQRQRVAIARALA
FT                   LDPAVIVCDEPSSALDVTTQARVLRLFRDIQEATGVAYLFISHDLGVVNEISDRIAVLY
FT                   RGEIVELGAANQVATAPRHEYTRRLQMAAPVADPRKQRERRRLRLAL"
     MTDQPLLRVR DLVVRFAGRR RTSTTVIHGV SFDLAAGETL SLVGESGSGK TTIGRAILGL        60
     APVSEGTVEF RSEIISNVPR ARRRELARDV QVVFQDPYSS LNPSMTVGDI LVEPLTTAGV       120
     EGGRTRVKEL LDAVGLPADA ANRYPREFSG GQRQRVAIAR ALALDPAVIV CDEPSSALDV       180
     TTQARVLRLF RDIQEATGVA YLFISHDLGV VNEISDRIAV LYRGEIVELG AANQVATAPR       240
     HEYTRRLQMA APVADPRKQR ERRRLRLAL                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page