(data stored in ACNUC7421 zone)

EMBL: CP000820.PE428

CP000820.PE428       Location/Qualifiers
FT   CDS             510321..512048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ani:AN0478.2 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09897"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF8"
FT                   /protein_id="ABW09897.1"
FT                   /translation="MKAVLSSLLLTAGLILVPAGAASAAPPDCAAATPGGPVQVTPGCV
FT                   DPLYADPVVDSEQDLSTPVTHRRVSGHFDGTGVKFTIYLPPARQWQGRFFQYTYPISTE
FT                   NALDRSVAFGAASGAYTLQTSGTGGYRHAAAAAKFAETAAAAYYRSGSRRIYGYLYGPS
FT                   GGSFQTVGAIENTTGVWEGAVPVVLGVPTSIPINFFVRAQARMVLRDVADQIADAVRPG
FT                   GSGNPYTGLTPVQAAMLHETTSLGVPLKAWADPDYVLGLSAPDGLLGFGAVIKQLDPTY
FT                   ADDFWSKPGYLGTEQSALGDIVRAELARTGDRWAVALPSYYRHQVPPAGEGYDVFDSLR
FT                   GRYPQRPLLVGPAIATSVAGGGTYTGRINGKVIVVDNLVDSDAYPWHADWYARRVQSPG
FT                   DFRLYYNDNADHLEGPVTGAKASRIVSYDPIVEQALRDLAAWAERGVRPPQSTRYTVTG
FT                   GQVRVPSTAAQRRGIQPVVDLTVRGRDRVDVNAGEKVDFRAQVATPPGAGRIVSAGWDV
FT                   TGSGTFTPATTGFTASHRFTEPGTYYVSLKVAASRSGHAESFAMVENLDRVRVVVHPR"
     MKAVLSSLLL TAGLILVPAG AASAAPPDCA AATPGGPVQV TPGCVDPLYA DPVVDSEQDL        60
     STPVTHRRVS GHFDGTGVKF TIYLPPARQW QGRFFQYTYP ISTENALDRS VAFGAASGAY       120
     TLQTSGTGGY RHAAAAAKFA ETAAAAYYRS GSRRIYGYLY GPSGGSFQTV GAIENTTGVW       180
     EGAVPVVLGV PTSIPINFFV RAQARMVLRD VADQIADAVR PGGSGNPYTG LTPVQAAMLH       240
     ETTSLGVPLK AWADPDYVLG LSAPDGLLGF GAVIKQLDPT YADDFWSKPG YLGTEQSALG       300
     DIVRAELART GDRWAVALPS YYRHQVPPAG EGYDVFDSLR GRYPQRPLLV GPAIATSVAG       360
     GGTYTGRING KVIVVDNLVD SDAYPWHADW YARRVQSPGD FRLYYNDNAD HLEGPVTGAK       420
     ASRIVSYDPI VEQALRDLAA WAERGVRPPQ STRYTVTGGQ VRVPSTAAQR RGIQPVVDLT       480
     VRGRDRVDVN AGEKVDFRAQ VATPPGAGRI VSAGWDVTGS GTFTPATTGF TASHRFTEPG       540
     TYYVSLKVAA SRSGHAESFA MVENLDRVRV VVHPR                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page