(data stored in ACNUC7421 zone)

EMBL: CP000820.PE429

CP000820.PE429       Location/Qualifiers
FT   CDS             512058..513767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_6525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09898"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032260"
FT                   /db_xref="InterPro:IPR041239"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF9"
FT                   /protein_id="ABW09898.1"
FT                   /translation="MLTHFITVGQVLDAPGGRDVLERFLPQAVDRADVRELLVLFFLRV
FT                   TPGLRDDEQARAAFWAEIDALMEPVILRPHAAAIAPSAVGVSAPHASAPWTVAGSPTRW
FT                   GLLEIQLSGPSDGNPFIDVELTAEFRCGERSWTVGGFYDGDGTYRLRALAEQEGTWQFV
FT                   TSSTTPALDGIEGEVTVGPAAPGAHGPVRVDGFHFAYADGTRYRPWGTTAYAWNHQDDK
FT                   TQEQTLETLAASPFTKLRMCLFPKHFVFNNAEPVQFPFPRVNGSFDHTRFDVEFFARLD
FT                   EQVRRLGELGIEADVILFHPYDKWGFSDLGRAVDERVVRYLVRRLAGYAHVWFSLANEY
FT                   DAVPGKTIADWDRIGETLTAEDPHGHPVSIHNFIEHFDHTRPWITHASVQHGRVEEVTG
FT                   WRERWGKPVVIDETGYEGDLEFDWGNLTGEEMLRRFWEGAVRGGYVGHGETYWNAEERI
FT                   WWAKGGQLTGTSPRRIGFLAEIVAASPTGVLEPLPSDYDLPWAGVQDEYLVNYYGLGRP
FT                   RERHILLPPGRWHVDVLDTWECTVERLPGTYETLAVVPLPAKPYQAVRLVKA"
     MLTHFITVGQ VLDAPGGRDV LERFLPQAVD RADVRELLVL FFLRVTPGLR DDEQARAAFW        60
     AEIDALMEPV ILRPHAAAIA PSAVGVSAPH ASAPWTVAGS PTRWGLLEIQ LSGPSDGNPF       120
     IDVELTAEFR CGERSWTVGG FYDGDGTYRL RALAEQEGTW QFVTSSTTPA LDGIEGEVTV       180
     GPAAPGAHGP VRVDGFHFAY ADGTRYRPWG TTAYAWNHQD DKTQEQTLET LAASPFTKLR       240
     MCLFPKHFVF NNAEPVQFPF PRVNGSFDHT RFDVEFFARL DEQVRRLGEL GIEADVILFH       300
     PYDKWGFSDL GRAVDERVVR YLVRRLAGYA HVWFSLANEY DAVPGKTIAD WDRIGETLTA       360
     EDPHGHPVSI HNFIEHFDHT RPWITHASVQ HGRVEEVTGW RERWGKPVVI DETGYEGDLE       420
     FDWGNLTGEE MLRRFWEGAV RGGYVGHGET YWNAEERIWW AKGGQLTGTS PRRIGFLAEI       480
     VAASPTGVLE PLPSDYDLPW AGVQDEYLVN YYGLGRPRER HILLPPGRWH VDVLDTWECT       540
     VERLPGTYET LAVVPLPAKP YQAVRLVKA                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page