(data stored in ACNUC7421 zone)

EMBL: CP000820.PE431

CP000820.PE431       Location/Qualifiers
FT   CDS             514801..517170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0435"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: tpt:Tpet_0848 glycoside hydrolase, family 3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09900"
FT                   /db_xref="GOA:A8LGG1"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG1"
FT                   /protein_id="ABW09900.1"
FT                   /translation="MSPTWRDEHLEAGHRAELLLAEMTTAEKCHQLTARMAWSLVKADG
FT                   TDADGAEDVLRHPPGHVAQLILDDPAQLAAMVGTIQKQVLSRSRLGIPVLFHAEALSGF
FT                   LNGGHMVFPSGTGLAAGWSPDLVEEMTDLIRRQMRRTGLMHALSPVLDVALDPRWGRVH
FT                   ETFGEDPYLCAALGVAYVRGLQGTDVSQGVMATGKHFLGYAAPPGGLNLSAFESGARRT
FT                   RDLFAYPFEAAIRLAGLRSVMNSYADVDGVPAGASPEVLQDLLRDTLGFDGFVSSDYTT
FT                   LEQLVDRQRIAKDAAEAGRLAIRAGLDVEMPNPYGYGDVLAAEVERGVVDVRHVDNCVR
FT                   RVLRAKFEVGLFEHPYPVESIDVAAAAREGADLSLELARRSIVLGQNNGILPLTPGGLD
FT                   IAVIGPHADAPTFQFPTYTYVSWREANEAVMRGELGTMNGAEETVSAWYSALFGAWDGD
FT                   SVAPSLAAEIGDHARTVRVERGCTLTEDLGSLDPAVEAARAADVVVLALGGASLWFTGE
FT                   RTEGEASDTADITLPAAQVRLAEAVAATGTPLAVVLVQGRAYALPKVIQDAAAIVVAPY
FT                   AGPFGTQAIADVLFGVVNPCGKMPYSLPRHSGQIPVYHHQKAGSGYRNPLPPSVSRHYL
FT                   DLEATPLWPFAHGLSYTTFALSDLDCGADIDAYGTAHVSATVANTGPRDGATVMQLYLR
FT                   VNTSPVTRPAQQLAGFTRVELAAGESRRVTFEIDASQLAYTSLARQVAVEPALVDVFVG
FT                   LDSDDRSLAGSFAVVGSARVVEGAERSFLSRARPHP"
     MSPTWRDEHL EAGHRAELLL AEMTTAEKCH QLTARMAWSL VKADGTDADG AEDVLRHPPG        60
     HVAQLILDDP AQLAAMVGTI QKQVLSRSRL GIPVLFHAEA LSGFLNGGHM VFPSGTGLAA       120
     GWSPDLVEEM TDLIRRQMRR TGLMHALSPV LDVALDPRWG RVHETFGEDP YLCAALGVAY       180
     VRGLQGTDVS QGVMATGKHF LGYAAPPGGL NLSAFESGAR RTRDLFAYPF EAAIRLAGLR       240
     SVMNSYADVD GVPAGASPEV LQDLLRDTLG FDGFVSSDYT TLEQLVDRQR IAKDAAEAGR       300
     LAIRAGLDVE MPNPYGYGDV LAAEVERGVV DVRHVDNCVR RVLRAKFEVG LFEHPYPVES       360
     IDVAAAAREG ADLSLELARR SIVLGQNNGI LPLTPGGLDI AVIGPHADAP TFQFPTYTYV       420
     SWREANEAVM RGELGTMNGA EETVSAWYSA LFGAWDGDSV APSLAAEIGD HARTVRVERG       480
     CTLTEDLGSL DPAVEAARAA DVVVLALGGA SLWFTGERTE GEASDTADIT LPAAQVRLAE       540
     AVAATGTPLA VVLVQGRAYA LPKVIQDAAA IVVAPYAGPF GTQAIADVLF GVVNPCGKMP       600
     YSLPRHSGQI PVYHHQKAGS GYRNPLPPSV SRHYLDLEAT PLWPFAHGLS YTTFALSDLD       660
     CGADIDAYGT AHVSATVANT GPRDGATVMQ LYLRVNTSPV TRPAQQLAGF TRVELAAGES       720
     RRVTFEIDAS QLAYTSLARQ VAVEPALVDV FVGLDSDDRS LAGSFAVVGS ARVVEGAERS       780
     FLSRARPHP                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page