(data stored in ACNUC7421 zone)

EMBL: CP000820.PE432

CP000820.PE432       Location/Qualifiers
FT   CDS             517180..518205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0436"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   ret:RHE_PC00041 probable transcriptional regulator protein,
FT                   LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09901"
FT                   /db_xref="GOA:A8LGG2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG2"
FT                   /protein_id="ABW09901.1"
FT                   /translation="MVSTPDSQEARRVTIQDVAREAGVSVSAVSKVVRDAYGVSEGMRE
FT                   KVTAAIDALGYRPHTGARAMRGRSYSVGVMLTELTSPFQPQIINGITAQFEPTPYQEIL
FT                   IAAGTSPDRQKRSIEALIDRQVDGLIVIAPWMEQAWLEKLGASLPTVVLARHGGSGTFD
FT                   TIVGDDFEGARLMVDRLVALGHRRIVHTSQPSGGLERPYVLSHTPRLDGYEETMRRHGL
FT                   EPDVIVTSYSEEGGYEAARQALARPIPPTAIFAGADIAALGVLRAAEELGLRVPEDLSV
FT                   AGYDNIYMSTIGRISLTTIDQSAQLTGSRSARLLLERIDGRTQPVHYLIAPRLVARDTT
FT                   A"
     MVSTPDSQEA RRVTIQDVAR EAGVSVSAVS KVVRDAYGVS EGMREKVTAA IDALGYRPHT        60
     GARAMRGRSY SVGVMLTELT SPFQPQIING ITAQFEPTPY QEILIAAGTS PDRQKRSIEA       120
     LIDRQVDGLI VIAPWMEQAW LEKLGASLPT VVLARHGGSG TFDTIVGDDF EGARLMVDRL       180
     VALGHRRIVH TSQPSGGLER PYVLSHTPRL DGYEETMRRH GLEPDVIVTS YSEEGGYEAA       240
     RQALARPIPP TAIFAGADIA ALGVLRAAEE LGLRVPEDLS VAGYDNIYMS TIGRISLTTI       300
     DQSAQLTGSR SARLLLERID GRTQPVHYLI APRLVARDTT A                           341
//

If you have problems or comments...

PBIL Back to PBIL home page