(data stored in ACNUC7421 zone)

EMBL: CP000820.PE437

CP000820.PE437       Location/Qualifiers
FT   CDS             522170..523276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0441"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   stp:Strop_4141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09906"
FT                   /db_xref="GOA:A8LGG7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG7"
FT                   /protein_id="ABW09906.1"
FT                   /translation="MPAGQGPHRAGWMVMVWSLLYALTRNALGLMLLRVRGDTAKDVEL
FT                   LVLRHQVAVLRRQVNRPALEPADRVILAALSRLLPRAGWGSFFVTPATVLRWHRELLAR
FT                   KWTYPRKTPGRPPVRREIRELVLRLARENPTWGHRRIQGELIGLGYPVGVATVWRILHR
FT                   AGVDPAPRRADASWRTFLSAQASGLLACDFFMVDTVFLQRIYVFFVVEHATRRVHVLGV
FT                   TKHPTSAWVTQRARNLLMDLDERCHRFRFLIRDRDMKFTASFDAVFIGAGIDVVRTPPQ
FT                   APKANAIAERWVGTARRECTDRLLIVSERHLTSVLTTYAEHFNTHRPHRSLGQHPPDSP
FT                   PVVAPTLESTVRRTRILGGMINEYRNAA"
     MPAGQGPHRA GWMVMVWSLL YALTRNALGL MLLRVRGDTA KDVELLVLRH QVAVLRRQVN        60
     RPALEPADRV ILAALSRLLP RAGWGSFFVT PATVLRWHRE LLARKWTYPR KTPGRPPVRR       120
     EIRELVLRLA RENPTWGHRR IQGELIGLGY PVGVATVWRI LHRAGVDPAP RRADASWRTF       180
     LSAQASGLLA CDFFMVDTVF LQRIYVFFVV EHATRRVHVL GVTKHPTSAW VTQRARNLLM       240
     DLDERCHRFR FLIRDRDMKF TASFDAVFIG AGIDVVRTPP QAPKANAIAE RWVGTARREC       300
     TDRLLIVSER HLTSVLTTYA EHFNTHRPHR SLGQHPPDSP PVVAPTLEST VRRTRILGGM       360
     INEYRNAA                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page