(data stored in ACNUC7421 zone)

EMBL: CP000820.PE44

CP000820.PE44        Location/Qualifiers
FT   CDS             56774..60883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lpf:lpl0694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09513"
FT                   /db_xref="InterPro:IPR022118"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB52"
FT                   /protein_id="ABW09513.1"
FT                   /translation="MMRGKLNPDPVRPLDGYRVTANVDVPMLGDDGQTTTTVAVGADVT
FT                   SGGDVAIELPERRTGDVRLVATAPDGSRVGATTIAAANVDQPFTLDVTTVDPVTVVPSD
FT                   VPGLGRRERLVGRVLDPQGAGAPAKLLVVVWGVPHGAQPTDAVPLLVAETAAGGYFGDD
FT                   LPPDELDDAWAKVAGGAPVPILLDGGRLPRTVVIVTPVKASHDNDDDGCGCHAAPPRSP
FT                   DQADLAANPEAFAADPGRCVDLTVPNRALEEVTFHAVVRTTQPEIRGLQMPNADDVPSP
FT                   VVDRLVQLVASRPIEAIARLESPSTYTTSVDAAIKPASSPQLAALAVRAAVPEVDEPTV
FT                   RRSLNLRADVVGELMRDGAHLRVDDLLHAERVSTIRTVRDIVQAVGGAPAGRVELGGET
FT                   QVDWDDTPTLYQATTIAHGHLLTFKQVWRADGYSLGDLLYSLPLAPGQKKLIAVVDWDR
FT                   REVEVRQAQRSETEVLDASLAHDRDISEVISSSLRQSMRGSSSADTESIAGGIAGFIGP
FT                   VVFGFGGGSSSAGSTASQRSSRDVAGTMLNQARDRTLQAASAVRSQRATVVQTARQGES
FT                   LRVQTDVVANHNHCHAMTVEYFEVLRHLQVTQEIAHVQECLFVPFEITPFNGAKALRHR
FT                   DVLVRHVPGALRRGFDALERMRTNWSDADFPLARYADEPLTYLDGELQMSFSIPRPADG
FT                   GTDKDQFDSSKWSVYEASGLLAQPAQTLWNAYLGTAVVANRDAIFAASIAPNIAQRIVD
FT                   RLALRLVLDNGSPVGVGIDATLVSRYRPDAPLLVSLRPTSTTPAVVRAQIERAVISLGA
FT                   LLPPEAKLVVQQAGLRYRTAHLEHDLVPTQRTYNDLGPGDEVELVVGLDRQEKRNPRAE
FT                   DPRLADALVDHLNEHIEHYHQAIWREMDPNRRYLLLDGFVAPNAGGRSVASVVENRLIG
FT                   IVGNCLVMPVVPGVKLDRSYEHSKRTQTDLLDLYATDPAPPMRISLPTKGVFAEAVLGA
FT                   CNSCELKDDTRFWRWEESPIPDEPTPIEQVSTATRRSTVPNLTPDAFPQALVRFQDVPT
FT                   APAPSALAAALELIGTPNLFSDITGLALNQANSAAALEEASKTATFFAQQGAALAQQRF
FT                   LASDTQRQLKRIKDARDQKLITPEQANERAMSLLQGATGERRPEGQVTTANPAVQKVLD
FT                   RVSQSSNASMTLRRPDGTVSVKKGDDAGGRIDVTADPPVGLIKQPTNLVCWAVAGAMMA
FT                   NWRDRRSATIQTVLDELGGTWRAKFDANQALAVAETVGFTKALGLVAEGPASYLPIGIA
FT                   RLVETYGPLWVISDDTVENNQLVHVRIVTGISGGGTAETTMVNIVDPDLDQPTTETFAE
FT                   FARRLEANDAIDVGLGIMRFPTVQTT"
     MMRGKLNPDP VRPLDGYRVT ANVDVPMLGD DGQTTTTVAV GADVTSGGDV AIELPERRTG        60
     DVRLVATAPD GSRVGATTIA AANVDQPFTL DVTTVDPVTV VPSDVPGLGR RERLVGRVLD       120
     PQGAGAPAKL LVVVWGVPHG AQPTDAVPLL VAETAAGGYF GDDLPPDELD DAWAKVAGGA       180
     PVPILLDGGR LPRTVVIVTP VKASHDNDDD GCGCHAAPPR SPDQADLAAN PEAFAADPGR       240
     CVDLTVPNRA LEEVTFHAVV RTTQPEIRGL QMPNADDVPS PVVDRLVQLV ASRPIEAIAR       300
     LESPSTYTTS VDAAIKPASS PQLAALAVRA AVPEVDEPTV RRSLNLRADV VGELMRDGAH       360
     LRVDDLLHAE RVSTIRTVRD IVQAVGGAPA GRVELGGETQ VDWDDTPTLY QATTIAHGHL       420
     LTFKQVWRAD GYSLGDLLYS LPLAPGQKKL IAVVDWDRRE VEVRQAQRSE TEVLDASLAH       480
     DRDISEVISS SLRQSMRGSS SADTESIAGG IAGFIGPVVF GFGGGSSSAG STASQRSSRD       540
     VAGTMLNQAR DRTLQAASAV RSQRATVVQT ARQGESLRVQ TDVVANHNHC HAMTVEYFEV       600
     LRHLQVTQEI AHVQECLFVP FEITPFNGAK ALRHRDVLVR HVPGALRRGF DALERMRTNW       660
     SDADFPLARY ADEPLTYLDG ELQMSFSIPR PADGGTDKDQ FDSSKWSVYE ASGLLAQPAQ       720
     TLWNAYLGTA VVANRDAIFA ASIAPNIAQR IVDRLALRLV LDNGSPVGVG IDATLVSRYR       780
     PDAPLLVSLR PTSTTPAVVR AQIERAVISL GALLPPEAKL VVQQAGLRYR TAHLEHDLVP       840
     TQRTYNDLGP GDEVELVVGL DRQEKRNPRA EDPRLADALV DHLNEHIEHY HQAIWREMDP       900
     NRRYLLLDGF VAPNAGGRSV ASVVENRLIG IVGNCLVMPV VPGVKLDRSY EHSKRTQTDL       960
     LDLYATDPAP PMRISLPTKG VFAEAVLGAC NSCELKDDTR FWRWEESPIP DEPTPIEQVS      1020
     TATRRSTVPN LTPDAFPQAL VRFQDVPTAP APSALAAALE LIGTPNLFSD ITGLALNQAN      1080
     SAAALEEASK TATFFAQQGA ALAQQRFLAS DTQRQLKRIK DARDQKLITP EQANERAMSL      1140
     LQGATGERRP EGQVTTANPA VQKVLDRVSQ SSNASMTLRR PDGTVSVKKG DDAGGRIDVT      1200
     ADPPVGLIKQ PTNLVCWAVA GAMMANWRDR RSATIQTVLD ELGGTWRAKF DANQALAVAE      1260
     TVGFTKALGL VAEGPASYLP IGIARLVETY GPLWVISDDT VENNQLVHVR IVTGISGGGT      1320
     AETTMVNIVD PDLDQPTTET FAEFARRLEA NDAIDVGLGI MRFPTVQTT                  1369
//

If you have problems or comments...

PBIL Back to PBIL home page