(data stored in ACNUC7421 zone)

EMBL: CP000820.PE441

CP000820.PE441       Location/Qualifiers
FT   CDS             525541..526257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0446"
FT                   /product="Hedgehog/intein hint domain protein"
FT                   /note="SMART: Hedgehog/intein hint domain protein; KEGG:
FT                   stp:Strop_0303 YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09910"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH1"
FT                   /protein_id="ABW09910.1"
FT                   /translation="MGADKFWAGVRASLAGVKPPAPARGYTFDPSRASQDDLNRTLARG
FT                   SAANPTVCSAQCPGSTVSGGLSRDRCGDACMYIGVGAGIAAIAGVTVLTDGLIAAPEGA
FT                   AAGGLGRAVRGCTGRNSFDGATGVLMADGTHKPIRDVHVGDQVLATDPTTGRTEPHTVT
FT                   NLIIGTGDKHLVDITLDTPGPDATLTATDHHPFWDETDHTWVDADDLTTTNRLRTPTGT
FT                   LLAVVACGVPEVGLSL"
     MGADKFWAGV RASLAGVKPP APARGYTFDP SRASQDDLNR TLARGSAANP TVCSAQCPGS        60
     TVSGGLSRDR CGDACMYIGV GAGIAAIAGV TVLTDGLIAA PEGAAAGGLG RAVRGCTGRN       120
     SFDGATGVLM ADGTHKPIRD VHVGDQVLAT DPTTGRTEPH TVTNLIIGTG DKHLVDITLD       180
     TPGPDATLTA TDHHPFWDET DHTWVDADDL TTTNRLRTPT GTLLAVVACG VPEVGLSL         238
//

If you have problems or comments...

PBIL Back to PBIL home page