(data stored in ACNUC7421 zone)

EMBL: CP000820.PE444

CP000820.PE444       Location/Qualifiers
FT   CDS             529072..530640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0449"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rle:RL0228 putative solute-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09913"
FT                   /db_xref="GOA:A8LGH4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH4"
FT                   /protein_id="ABW09913.1"
FT                   /translation="MIDGALSRRQVLGAALATVALAGASSCAGEEQSSGDGGSGRPSAS
FT                   REQTLSLAIQATPNSFDPAELTSGQSSFVWSALYDTLIWKDNKGKLQPNAAESWNYSDG
FT                   GRTLTLKLRKGMSFSSGAPVNAVAVKTTLERSKNTPGFTDQVLGALESVDAPDDRTVVL
FT                   RLSHPDGALLDSLAVSGAGVIGDPATLNDKRTALNPVGSGPYVLNTGQTVNGSTYVLDR
FT                   REDYWNVQAYPFKTVKISVIRDRTAALNALQAGEVNAGTVEVTNVDRLRAAGFDAAVVE
FT                   AHSLASLVLADRTGESLKPLGDPRVRQAINMAFDREKIVEQLLRGSGKPTEQVFNPKDP
FT                   AYDPALNTTYAYDPQRAKRLLAEAGYPNGFSVTMPEFFLAKSFAPTITQSLAAIGITTT
FT                   WEPVPPQQTDAAISSKKYPAFFLIAGLETTAGDASRYFSKDGAFNPFHAEDPDLTPQVE
FT                   QATQTIDPRQAADAYRHVNATAVRDAWNAPLFYVAVHWVTKKGITYLGDGSLTFNTVRA
FT                   FGLSG"
     MIDGALSRRQ VLGAALATVA LAGASSCAGE EQSSGDGGSG RPSASREQTL SLAIQATPNS        60
     FDPAELTSGQ SSFVWSALYD TLIWKDNKGK LQPNAAESWN YSDGGRTLTL KLRKGMSFSS       120
     GAPVNAVAVK TTLERSKNTP GFTDQVLGAL ESVDAPDDRT VVLRLSHPDG ALLDSLAVSG       180
     AGVIGDPATL NDKRTALNPV GSGPYVLNTG QTVNGSTYVL DRREDYWNVQ AYPFKTVKIS       240
     VIRDRTAALN ALQAGEVNAG TVEVTNVDRL RAAGFDAAVV EAHSLASLVL ADRTGESLKP       300
     LGDPRVRQAI NMAFDREKIV EQLLRGSGKP TEQVFNPKDP AYDPALNTTY AYDPQRAKRL       360
     LAEAGYPNGF SVTMPEFFLA KSFAPTITQS LAAIGITTTW EPVPPQQTDA AISSKKYPAF       420
     FLIAGLETTA GDASRYFSKD GAFNPFHAED PDLTPQVEQA TQTIDPRQAA DAYRHVNATA       480
     VRDAWNAPLF YVAVHWVTKK GITYLGDGSL TFNTVRAFGL SG                          522
//

If you have problems or comments...

PBIL Back to PBIL home page