(data stored in ACNUC7421 zone)

EMBL: CP000820.PE446

CP000820.PE446       Location/Qualifiers
FT   CDS             531590..533383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0451"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: sil:SPO2552 peptide/opine/nickel
FT                   uptake family ABC transporter, permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09915"
FT                   /db_xref="GOA:A8LGH6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH6"
FT                   /protein_id="ABW09915.1"
FT                   /translation="MTTPASGTDTTKRRSTLRRLCKDPQAVVTSSVLLIIALLGALAPL
FT                   LTSHGPNEASLDAIDADVSTPGYPLGGDQSGRDIFARLLGSINTSMVSALIGTTVALTI
FT                   GVTGGLIGGYFGHRIRGFTEWVFNLVMTFPGLLLLIILMPVTKGDYRITMMIFGVLLSP
FT                   GVYRIVRNQVLSVRNELFVDAARVSGLSSPRILRRHILAAVRGPVIIATAFLLGASIGV
FT                   QAGLAFLGVGRSSVPSFGSMIAAGFESLYVEPLQIVWPSVMLGLITASLVLFGNAVRDT
FT                   LGASRRRPRKIHPSAPARPEKPDPSDDAPPGLLEVRNLTIAYPSPSGEPREVVRGVTLS
FT                   LQPGETLGVVGESSAGKTQIAFAALGVLPPGATITCGSITFDGRELLGRTERELRGIRG
FT                   RSIAYVPQEPMSNLDPCTTVGAQLVEGVQASTPMARRAARERVLALLGRVGIPDPKRTF
FT                   NSYPHQISGGMAQRVLIAGAVASRPRILIADEPTTALDVTIQADILDLLRDLQQELNMA
FT                   VLLVTHNFGVVADLCDRVAVMRRGEIVEMGTALDILGEPQHEYTRMLLASILDGSTTRT
FT                   DAPSGEISARDSVAVQVGEAR"
     MTTPASGTDT TKRRSTLRRL CKDPQAVVTS SVLLIIALLG ALAPLLTSHG PNEASLDAID        60
     ADVSTPGYPL GGDQSGRDIF ARLLGSINTS MVSALIGTTV ALTIGVTGGL IGGYFGHRIR       120
     GFTEWVFNLV MTFPGLLLLI ILMPVTKGDY RITMMIFGVL LSPGVYRIVR NQVLSVRNEL       180
     FVDAARVSGL SSPRILRRHI LAAVRGPVII ATAFLLGASI GVQAGLAFLG VGRSSVPSFG       240
     SMIAAGFESL YVEPLQIVWP SVMLGLITAS LVLFGNAVRD TLGASRRRPR KIHPSAPARP       300
     EKPDPSDDAP PGLLEVRNLT IAYPSPSGEP REVVRGVTLS LQPGETLGVV GESSAGKTQI       360
     AFAALGVLPP GATITCGSIT FDGRELLGRT ERELRGIRGR SIAYVPQEPM SNLDPCTTVG       420
     AQLVEGVQAS TPMARRAARE RVLALLGRVG IPDPKRTFNS YPHQISGGMA QRVLIAGAVA       480
     SRPRILIADE PTTALDVTIQ ADILDLLRDL QQELNMAVLL VTHNFGVVAD LCDRVAVMRR       540
     GEIVEMGTAL DILGEPQHEY TRMLLASILD GSTTRTDAPS GEISARDSVA VQVGEAR          597
//

If you have problems or comments...

PBIL Back to PBIL home page