(data stored in ACNUC7421 zone)

EMBL: CP000820.PE448

CP000820.PE448       Location/Qualifiers
FT   CDS             534469..536640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL3354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09917"
FT                   /db_xref="GOA:A8LGH8"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH8"
FT                   /protein_id="ABW09917.1"
FT                   /translation="MPMPNLRMTGTGRGRRAAPARTAGQADPPLPLPRRRRRAAPTALA
FT                   FAAVLAVGVTSLVGVSAAGAADAPDCQPRTSGGPLFVTATCVDPALNQPYTDIDEQRTT
FT                   TDPKTNVTVTYRYIHGGFTGTNAKFSLYFPAAAQYQGRFFESTYPTVTQEDATPDVIAF
FT                   AISNGAYVVSTNNGGGVAAAGGLGGYRINAASAKYSRVVAARVYHGMARPRGYIYGASG
FT                   GAYQTLGAMENTDGVWDGGVPMVPGVPNGIPSFQASQSLALRVLADKLPQIADAVAPGG
FT                   SGDPYKGLNPTQRQVLQEVTRLGFPLRGWWQYATLNGGSFSVVARTVRAVDPSYVNDFW
FT                   AAPGYEGSSDAAVKAARVQYDTTVTGLVGSPTSALTLSGVPGGDVSGADLVVTSGAAAG
FT                   KSVPIGTVTGTTVGFGFGADPAVTGAIKPGDEVRIDNSWLLALQYYQRHQVPSSDQYGW
FT                   NQYRGPNGDPLYPQRPILVGPLLAAGAGGAAPTGHFNGKMIMLASTMDTQAYPWSADWY
FT                   HKQASTALGGKLADSYRLWYMDNAEHGPDLADYTSAIPGAAAHIVGYTSALNQALLDLD
FT                   AWVVRGTRPPASTTYTVDGNTQINLPAAAAQRNGVQPVVTLSANNANSGHPIDVRVGQQ
FT                   VTFSVQAQVPPGAGKIVRTEWDFLGAGDYPITATNQPIEAAEKLRATYSYSKPGTYFPV
FT                   VRVTSQRDGNSHTPYGLIQNLAAVRIVVH"
     MPMPNLRMTG TGRGRRAAPA RTAGQADPPL PLPRRRRRAA PTALAFAAVL AVGVTSLVGV        60
     SAAGAADAPD CQPRTSGGPL FVTATCVDPA LNQPYTDIDE QRTTTDPKTN VTVTYRYIHG       120
     GFTGTNAKFS LYFPAAAQYQ GRFFESTYPT VTQEDATPDV IAFAISNGAY VVSTNNGGGV       180
     AAAGGLGGYR INAASAKYSR VVAARVYHGM ARPRGYIYGA SGGAYQTLGA MENTDGVWDG       240
     GVPMVPGVPN GIPSFQASQS LALRVLADKL PQIADAVAPG GSGDPYKGLN PTQRQVLQEV       300
     TRLGFPLRGW WQYATLNGGS FSVVARTVRA VDPSYVNDFW AAPGYEGSSD AAVKAARVQY       360
     DTTVTGLVGS PTSALTLSGV PGGDVSGADL VVTSGAAAGK SVPIGTVTGT TVGFGFGADP       420
     AVTGAIKPGD EVRIDNSWLL ALQYYQRHQV PSSDQYGWNQ YRGPNGDPLY PQRPILVGPL       480
     LAAGAGGAAP TGHFNGKMIM LASTMDTQAY PWSADWYHKQ ASTALGGKLA DSYRLWYMDN       540
     AEHGPDLADY TSAIPGAAAH IVGYTSALNQ ALLDLDAWVV RGTRPPASTT YTVDGNTQIN       600
     LPAAAAQRNG VQPVVTLSAN NANSGHPIDV RVGQQVTFSV QAQVPPGAGK IVRTEWDFLG       660
     AGDYPITATN QPIEAAEKLR ATYSYSKPGT YFPVVRVTSQ RDGNSHTPYG LIQNLAAVRI       720
     VVH                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page