(data stored in ACNUC7421 zone)

EMBL: CP000820.PE450

CP000820.PE450       Location/Qualifiers
FT   CDS             538299..540581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0456"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: rha:RHA1_ro02947 beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09919"
FT                   /db_xref="GOA:A8LGI0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI0"
FT                   /protein_id="ABW09919.1"
FT                   /translation="MIEAQHLVSTLALEEKAELVSGGGLWVTAEIPHAGVRPAVLTDGP
FT                   HGVRMTRDGVDTGHIANSFPATAFPTAAALGSSWNEDLLREIGAALGAESRALGVDVLL
FT                   GPGINIKRSPLCGRNFEYFAEDPLLAGALGAAWVEGVQSHGVGASVKHFAANNQETDRM
FT                   RVSADVDERTLREIYLPAFEHVVRQAHVATVMCSYNRINGVRASQNRWLLTTVLREEWG
FT                   FEGYVLSDWGAVHDPVAALQAGLDLEMPSSRGRSAAEIVGAVRAGALDERCLDLAVERQ
FT                   LATHQRLWLARGDGMETPDLPAYHVLARRAAAEGAVLLKNDGDLLPLDPATGGRIAVVG
FT                   EFARSPRYQGAGSSQVNPTRLDDALTAILAATSREVTFAPGFRLDGTADPVLLAEAVQA
FT                   ARDAESVVMFLGLPEQTESEGFDRTDLDLPAIQVELLEAVASVNSRVAVILSNGGVVLT
FT                   DPVISRAATLLEMWLSGQAGGSAAADLIFGHAAPAGRLAETIPHRLQDIPTYVNWPGAE
FT                   GHVNYGERLYVGYRWYDRTDEDVAFPFGFGLTYTTFAYSDLAVHLPDPARPEARVEVVV
FT                   TNTGRREAAEVVQLYISDPVADVDRPVRELRGFRKVRVAPGHSERVVIELDARAFSYWS
FT                   TRRGQWVVEPGEYGIHVGSSSRDLPMTQTINLDMAMPTPPLTEESTLAEWYDHPSGRHI
FT                   VRELLGKTMGAQDGLLENLGTWQFVAQMPLTALLKMSPSAGTEAKPLKDLLHAANNGNA
FT                   AQPTANV"
     MIEAQHLVST LALEEKAELV SGGGLWVTAE IPHAGVRPAV LTDGPHGVRM TRDGVDTGHI        60
     ANSFPATAFP TAAALGSSWN EDLLREIGAA LGAESRALGV DVLLGPGINI KRSPLCGRNF       120
     EYFAEDPLLA GALGAAWVEG VQSHGVGASV KHFAANNQET DRMRVSADVD ERTLREIYLP       180
     AFEHVVRQAH VATVMCSYNR INGVRASQNR WLLTTVLREE WGFEGYVLSD WGAVHDPVAA       240
     LQAGLDLEMP SSRGRSAAEI VGAVRAGALD ERCLDLAVER QLATHQRLWL ARGDGMETPD       300
     LPAYHVLARR AAAEGAVLLK NDGDLLPLDP ATGGRIAVVG EFARSPRYQG AGSSQVNPTR       360
     LDDALTAILA ATSREVTFAP GFRLDGTADP VLLAEAVQAA RDAESVVMFL GLPEQTESEG       420
     FDRTDLDLPA IQVELLEAVA SVNSRVAVIL SNGGVVLTDP VISRAATLLE MWLSGQAGGS       480
     AAADLIFGHA APAGRLAETI PHRLQDIPTY VNWPGAEGHV NYGERLYVGY RWYDRTDEDV       540
     AFPFGFGLTY TTFAYSDLAV HLPDPARPEA RVEVVVTNTG RREAAEVVQL YISDPVADVD       600
     RPVRELRGFR KVRVAPGHSE RVVIELDARA FSYWSTRRGQ WVVEPGEYGI HVGSSSRDLP       660
     MTQTINLDMA MPTPPLTEES TLAEWYDHPS GRHIVRELLG KTMGAQDGLL ENLGTWQFVA       720
     QMPLTALLKM SPSAGTEAKP LKDLLHAANN GNAAQPTANV                             760
//

If you have problems or comments...

PBIL Back to PBIL home page