(data stored in ACNUC7421 zone)

EMBL: CP000820.PE452

CP000820.PE452       Location/Qualifiers
FT   CDS             541777..543945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0458"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   fal:FRAAL4621 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09921"
FT                   /db_xref="GOA:A8LGI2"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI2"
FT                   /protein_id="ABW09921.1"
FT                   /translation="MSMAGSVLGSRSESRIRPEHTDRAAVVYVRQSSRQQVVEHAESTR
FT                   VQYALVERAVTLGWARSRVTVIDDDLGVSAAVAASRPGFARLVTEVTMGRVGLVLGVEM
FT                   SRLARTGRDWHQLIELCSLAGTLLADLDGVYDPGVYNDRLLLGLKGTMSEAELWLIRQR
FT                   MWGGKLAKAERGELAFALPIGYWRDRGGQVVFDPDEQARTVVGLVFDLFDRLGTLNGVL
FT                   RWLVDHQVQLPVRSHSGVDKGELTWRRPNRETLQVMLHNPIYAGYHAYGRRRVDARRRK
FT                   AGRPSTGRVVRSMDDWHVLLPDRMPAYIGTDRYAANLARLEANRQTAASPGAPRPGSAL
FT                   LAGLVRCGRCGHRMTVSYHTPASRFPSHNYHCGYLLATYGTGRTCQHLAGPALDRYVTA
FT                   QLLDAVAPAALEVSLAAAAHAESDRAELDTLWRQRLERARYAAGRARRQYQLAEPENRL
FT                   VTRQLETDWETALADLDRLETDYQRFVEARPQTLTAAERAAITALAHDLPALWTAPTTS
FT                   QTDRKQLLRTLIDEITVTVVGTSELVDVTITWAGGHQTHGRTTRPVARLDQLSYYHHLV
FT                   ERVSELASAGHSSRQIADQLNTEGLRPPKRTTRFGPDQILTLTRRLGIGVHHPRDTRTA
FT                   LANPGPGRWSVAGLAVALNMPTATLYTWIYRGWITAERHPDGRSWIILADDVEIRQLRE
FT                   RRDRPPGYYTRARWTRPHLDHSTNGTRT"
     MSMAGSVLGS RSESRIRPEH TDRAAVVYVR QSSRQQVVEH AESTRVQYAL VERAVTLGWA        60
     RSRVTVIDDD LGVSAAVAAS RPGFARLVTE VTMGRVGLVL GVEMSRLART GRDWHQLIEL       120
     CSLAGTLLAD LDGVYDPGVY NDRLLLGLKG TMSEAELWLI RQRMWGGKLA KAERGELAFA       180
     LPIGYWRDRG GQVVFDPDEQ ARTVVGLVFD LFDRLGTLNG VLRWLVDHQV QLPVRSHSGV       240
     DKGELTWRRP NRETLQVMLH NPIYAGYHAY GRRRVDARRR KAGRPSTGRV VRSMDDWHVL       300
     LPDRMPAYIG TDRYAANLAR LEANRQTAAS PGAPRPGSAL LAGLVRCGRC GHRMTVSYHT       360
     PASRFPSHNY HCGYLLATYG TGRTCQHLAG PALDRYVTAQ LLDAVAPAAL EVSLAAAAHA       420
     ESDRAELDTL WRQRLERARY AAGRARRQYQ LAEPENRLVT RQLETDWETA LADLDRLETD       480
     YQRFVEARPQ TLTAAERAAI TALAHDLPAL WTAPTTSQTD RKQLLRTLID EITVTVVGTS       540
     ELVDVTITWA GGHQTHGRTT RPVARLDQLS YYHHLVERVS ELASAGHSSR QIADQLNTEG       600
     LRPPKRTTRF GPDQILTLTR RLGIGVHHPR DTRTALANPG PGRWSVAGLA VALNMPTATL       660
     YTWIYRGWIT AERHPDGRSW IILADDVEIR QLRERRDRPP GYYTRARWTR PHLDHSTNGT       720
     RT                                                                      722
//

If you have problems or comments...

PBIL Back to PBIL home page