(data stored in ACNUC7421 zone)

EMBL: CP000820.PE454

CP000820.PE454       Location/Qualifiers
FT   CDS             complement(544161..544409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09923"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI4"
FT                   /protein_id="ABW09923.1"
FT                   /translation="MTSIEAPWKKDSRPGENVRSDFMCLFSCIGSIQGVSAVCSPALIY
FT                   RRPDVPPGFRRTRWLGRHRHAGARRAQGHPKWVFDLS"
     MTSIEAPWKK DSRPGENVRS DFMCLFSCIG SIQGVSAVCS PALIYRRPDV PPGFRRTRWL        60
     GRHRHAGARR AQGHPKWVFD LS                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page