(data stored in ACNUC7421 zone)

EMBL: CP000820.PE456

CP000820.PE456       Location/Qualifiers
FT   CDS             complement(546324..547541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL3800 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09925"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI6"
FT                   /protein_id="ABW09925.1"
FT                   /translation="MPLDELTRWLGAAAVAALTVAVTGCSVVGGGGDAPVAACESPGVT
FT                   ADKVHVGFVFSDSGSGSSALSSARAGVDARIGLANDAGGVNGRHIVYDWRDDAGSPSQN
FT                   ARVTEELVHDESVFGLISATAAGSGSLDSLSAMGIPVTGLANPTWAKYPNLFAYMYDVS
FT                   PVVTARYIQANGGTKAAFVMTGSPAFTVQTIERYKTAFAAIGVGTTETISYASGVDSPT
FT                   QAVERMVNSGANAIVAFTTPKDLVEILQTASAANLRFSSTVSVTGYDRGVLKTYGPQLA
FT                   GVSFTVNFHPFEMRNASMDRYRDAMTRFAPESSVPEQQFALYGYLYTDLFIRGLELAGE
FT                   CPTREGFIKSLRKVTDYDAGGLIEPVDLSTNRTQPLQCNAFVRINPDGTAFDIAGARLC
FT                   ADGTGA"
     MPLDELTRWL GAAAVAALTV AVTGCSVVGG GGDAPVAACE SPGVTADKVH VGFVFSDSGS        60
     GSSALSSARA GVDARIGLAN DAGGVNGRHI VYDWRDDAGS PSQNARVTEE LVHDESVFGL       120
     ISATAAGSGS LDSLSAMGIP VTGLANPTWA KYPNLFAYMY DVSPVVTARY IQANGGTKAA       180
     FVMTGSPAFT VQTIERYKTA FAAIGVGTTE TISYASGVDS PTQAVERMVN SGANAIVAFT       240
     TPKDLVEILQ TASAANLRFS STVSVTGYDR GVLKTYGPQL AGVSFTVNFH PFEMRNASMD       300
     RYRDAMTRFA PESSVPEQQF ALYGYLYTDL FIRGLELAGE CPTREGFIKS LRKVTDYDAG       360
     GLIEPVDLST NRTQPLQCNA FVRINPDGTA FDIAGARLCA DGTGA                       405
//

If you have problems or comments...

PBIL Back to PBIL home page