(data stored in ACNUC7421 zone)

EMBL: CP000820.PE463

CP000820.PE463       Location/Qualifiers
FT   CDS             complement(553850..554917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0469"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   fal:FRAAL0474 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09932"
FT                   /db_xref="GOA:A8LGJ3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGJ3"
FT                   /protein_id="ABW09932.1"
FT                   /translation="MFVRLLYLIFVRVCGWLVLLGRSSASKDIELLVLRHEVAVLRRTQ
FT                   PKPRWDWADRAVLAALIRLLPKALRAHRLVTPGTVLRWHRRLIVRKWTHPQRMGRPPVG
FT                   TEIVPLIERLATENTTWGYQRIRGELLKLGHRVSASTIRRVLTSLGLPPAPQRQTDTTW
FT                   RQFLRTQASTMLAVDFFHVDCAVTLRRLYCFFVIEVGSRTVHILGVTAHPDGPWTTQQI
FT                   RNLLMNLGDRAADFQVLIRDRAGQFTASFDAVLIDAGITTIKIPPRTPRANAYAERFVR
FT                   TVRTEVTDRMLIFGERHLRVVLAEYARHYNGRRPHRALRLQPPRPDHPIADVTTARIKR
FT                   RPVLGGLINEYERAA"
     MFVRLLYLIF VRVCGWLVLL GRSSASKDIE LLVLRHEVAV LRRTQPKPRW DWADRAVLAA        60
     LIRLLPKALR AHRLVTPGTV LRWHRRLIVR KWTHPQRMGR PPVGTEIVPL IERLATENTT       120
     WGYQRIRGEL LKLGHRVSAS TIRRVLTSLG LPPAPQRQTD TTWRQFLRTQ ASTMLAVDFF       180
     HVDCAVTLRR LYCFFVIEVG SRTVHILGVT AHPDGPWTTQ QIRNLLMNLG DRAADFQVLI       240
     RDRAGQFTAS FDAVLIDAGI TTIKIPPRTP RANAYAERFV RTVRTEVTDR MLIFGERHLR       300
     VVLAEYARHY NGRRPHRALR LQPPRPDHPI ADVTTARIKR RPVLGGLINE YERAA            355
//

If you have problems or comments...

PBIL Back to PBIL home page