(data stored in ACNUC7421 zone)

EMBL: CP000820.PE464

CP000820.PE464       Location/Qualifiers
FT   CDS             complement(556027..556842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09933"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGJ4"
FT                   /protein_id="ABW09933.1"
FT                   /translation="MVVSLGRRLEVTTTPLLPFTNWRFTPASSEQLRTAASKKAWGDSR
FT                   SIIGEFNGDQPSPWTAWIPEQPPPHSGPDTVTVAHALSAGFEPGRTFGVYPVSERNRIA
FT                   TRPGATLRKDARLPGGRLIEPATEPAWLTRLLTPDPHAFAPWEHPVDRVEASHDGAQLL
FT                   LSIRSARGETPATVQIQELSDRLDVLVSVGIEPGHGPLPVPGEFVPSSPIGSRPGRRAG
FT                   LIRLSPERLRLIRVTLTHPLGDRAVYDLAHQDQTARDTARRAWKDQWNS"
     MVVSLGRRLE VTTTPLLPFT NWRFTPASSE QLRTAASKKA WGDSRSIIGE FNGDQPSPWT        60
     AWIPEQPPPH SGPDTVTVAH ALSAGFEPGR TFGVYPVSER NRIATRPGAT LRKDARLPGG       120
     RLIEPATEPA WLTRLLTPDP HAFAPWEHPV DRVEASHDGA QLLLSIRSAR GETPATVQIQ       180
     ELSDRLDVLV SVGIEPGHGP LPVPGEFVPS SPIGSRPGRR AGLIRLSPER LRLIRVTLTH       240
     PLGDRAVYDL AHQDQTARDT ARRAWKDQWN S                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page