(data stored in ACNUC7421 zone)

EMBL: CP000820.PE473

CP000820.PE473       Location/Qualifiers
FT   CDS             565947..566702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0480"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: psb:Psyr_4922 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09942"
FT                   /db_xref="GOA:A8LGK3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK3"
FT                   /protein_id="ABW09942.1"
FT                   /translation="MSSLTGKPAALVTGGTTGIGLATAQMLHADGFDVLITGQNPETLA
FT                   AAAEQLPADVVVLRSDARTLSEPDRVAAAVRDRFGRLDVVFLNAGIGRLVPIEAVDEAT
FT                   YDEMFDVNVRSQLFTLQRVLPLLRDGGSVVFSTALGATLGLADWSVYSATKGALTALVH
FT                   ALAVELAPRGIRVNAVSAGPADTPALSKLGLPDAALATMRKDLAAAIPLGRLGVAQDVA
FT                   RAVAFLGSPAAGFVTGTTIAVDGGLGVAV"
     MSSLTGKPAA LVTGGTTGIG LATAQMLHAD GFDVLITGQN PETLAAAAEQ LPADVVVLRS        60
     DARTLSEPDR VAAAVRDRFG RLDVVFLNAG IGRLVPIEAV DEATYDEMFD VNVRSQLFTL       120
     QRVLPLLRDG GSVVFSTALG ATLGLADWSV YSATKGALTA LVHALAVELA PRGIRVNAVS       180
     AGPADTPALS KLGLPDAALA TMRKDLAAAI PLGRLGVAQD VARAVAFLGS PAAGFVTGTT       240
     IAVDGGLGVA V                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page