(data stored in ACNUC7421 zone)

EMBL: CP000820.PE475

CP000820.PE475       Location/Qualifiers
FT   CDS             567588..568082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_4211 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09944"
FT                   /db_xref="GOA:A8LGK5"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK5"
FT                   /protein_id="ABW09944.1"
FT                   /translation="MDKAELDEQNRRVTAEFLTRGGVVSGDYQGMPLLLLHHVGARTGH
FT                   ARVNPMTYLAVNHSFAVFASNGGAAVHPDWYHNLLAHPTVSVVVGTETFPMVARVATGA
FT                   ERESIWARQKAVNPLFAELERATTRQIPVVILDRTPAPLPAPEPEPTPVPASSKDGDDR
FT                   R"
     MDKAELDEQN RRVTAEFLTR GGVVSGDYQG MPLLLLHHVG ARTGHARVNP MTYLAVNHSF        60
     AVFASNGGAA VHPDWYHNLL AHPTVSVVVG TETFPMVARV ATGAERESIW ARQKAVNPLF       120
     AELERATTRQ IPVVILDRTP APLPAPEPEP TPVPASSKDG DDRR                        164
//

If you have problems or comments...

PBIL Back to PBIL home page