(data stored in ACNUC7421 zone)

EMBL: CP000820.PE476

CP000820.PE476       Location/Qualifiers
FT   CDS             568079..568966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0483"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; NmrA
FT                   family protein; KEGG: gvi:gll2891 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09945"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK6"
FT                   /protein_id="ABW09945.1"
FT                   /translation="MTVLVVGATGRTASYLVMCLLRDGVPVRALVRDRDKAETVFRATR
FT                   RPATGHLEIVSGPFDDPALLLSATKGVDAAFLALSTSPQQIALERNVVDAAVRAELPHL
FT                   VRLSVFDADLDAGYEIGRRHGELDAYLAASGVPHTLLRPTYFSSNLLVAAPSIAATSQW
FT                   AGLAPDGRVALIDTRDVAEAAAVVLRDPAGRGAAYQLTGPEALTFTEIAECFSRVLGRR
FT                   ISYDAADEAHVRAAMAARGVPGWLADIAVGIDLAMQAGRHSQVTNEIRALTGAAPRPLE
FT                   AFIESNRAAYTPAG"
     MTVLVVGATG RTASYLVMCL LRDGVPVRAL VRDRDKAETV FRATRRPATG HLEIVSGPFD        60
     DPALLLSATK GVDAAFLALS TSPQQIALER NVVDAAVRAE LPHLVRLSVF DADLDAGYEI       120
     GRRHGELDAY LAASGVPHTL LRPTYFSSNL LVAAPSIAAT SQWAGLAPDG RVALIDTRDV       180
     AEAAAVVLRD PAGRGAAYQL TGPEALTFTE IAECFSRVLG RRISYDAADE AHVRAAMAAR       240
     GVPGWLADIA VGIDLAMQAG RHSQVTNEIR ALTGAAPRPL EAFIESNRAA YTPAG            295
//

If you have problems or comments...

PBIL Back to PBIL home page