(data stored in ACNUC7421 zone)

EMBL: CP000820.PE478

CP000820.PE478       Location/Qualifiers
FT   CDS             complement(569226..570305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0485"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   fal:FRAAL0474 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09947"
FT                   /db_xref="GOA:A8LGK8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK8"
FT                   /protein_id="ABW09947.1"
FT                   /translation="MMVHCVRTPAVSDLRAGLRLAGPPRSFVGVQGHRAAGVAARGHHA
FT                   APYPAQAPVGLGGPGGTRRTDPAFAEDTASAPTGHPRHRPTVAPPSNHTEMDLPAPDRT
FT                   TAGQHGDRDPHRAARDREHDVGIPADPGRAPHTRPPHWRVHDRRVLTSLGLPPAPKHQT
FT                   DTTWRQFLRTQASTMLAVDFFHVDCAVTLRRLYCFFVLEAGSRSVHILGVTAHPDGLWT
FT                   TQQIRNLLMDLGARTADFQFLIRDRAGQFTASFDAVLADAGITTVKIPPRTPRANAYAE
FT                   RFVHTVRTEVTDHMLIVGERHLRSVLAEYAAHYNGRRPHRSRDLQPPRPDHPIADLTKE
FT                   RIKRRPVLDGLINEYERAT"
     MMVHCVRTPA VSDLRAGLRL AGPPRSFVGV QGHRAAGVAA RGHHAAPYPA QAPVGLGGPG        60
     GTRRTDPAFA EDTASAPTGH PRHRPTVAPP SNHTEMDLPA PDRTTAGQHG DRDPHRAARD       120
     REHDVGIPAD PGRAPHTRPP HWRVHDRRVL TSLGLPPAPK HQTDTTWRQF LRTQASTMLA       180
     VDFFHVDCAV TLRRLYCFFV LEAGSRSVHI LGVTAHPDGL WTTQQIRNLL MDLGARTADF       240
     QFLIRDRAGQ FTASFDAVLA DAGITTVKIP PRTPRANAYA ERFVHTVRTE VTDHMLIVGE       300
     RHLRSVLAEY AAHYNGRRPH RSRDLQPPRP DHPIADLTKE RIKRRPVLDG LINEYERAT        359
//

If you have problems or comments...

PBIL Back to PBIL home page