(data stored in ACNUC7421 zone)

EMBL: CP000820.PE479

CP000820.PE479       Location/Qualifiers
FT   CDS             complement(570421..570762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0486"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: sen:SACE_0965
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09948"
FT                   /db_xref="GOA:A8LGK9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK9"
FT                   /protein_id="ABW09948.1"
FT                   /translation="MRIGELSARTGASVRSLRHYEKHGLLVADRGANGYRHFPESAVET
FT                   VARIQMLLGAGLSVATIRQVLPCTLDATPRIVPCAELSATLRGELARLEKQASQLDRAR
FT                   GLISTMLAG"
     MRIGELSART GASVRSLRHY EKHGLLVADR GANGYRHFPE SAVETVARIQ MLLGAGLSVA        60
     TIRQVLPCTL DATPRIVPCA ELSATLRGEL ARLEKQASQL DRARGLISTM LAG              113
//

If you have problems or comments...

PBIL Back to PBIL home page