(data stored in ACNUC7421 zone)

EMBL: CP000820.PE480

CP000820.PE480       Location/Qualifiers
FT   CDS             570804..571682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0487"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: sma:SAV7484
FT                   N5,N10-methylenetetrahydromethanopterin reductase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09949"
FT                   /db_xref="GOA:A8LGL0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGL0"
FT                   /protein_id="ABW09949.1"
FT                   /translation="MSDSMVRGMDIGIFTGITDEQIRPALLARAVEERGFESLFVAEHT
FT                   HIPVRRETPYPEGGDLPRDYYRTLDPFISLTTAAAVTTRLRLGTAIALVVQRDPILLAK
FT                   ETATLDLVSDGRFELGIGAGWLREEMRNHGTDPETRVPLMRERLAATKALWTSEQAEFH
FT                   GRFVDFDPIFQWPKPVQRPHPPVWIGGWGPTTFHRIVTDGDGWLAPPIPVDALARGVEE
FT                   LAEVANRAGTAAPPVTAILLNPDEAATEKAALLGVRRILFGLFPVTDADTTLRTLDHLG
FT                   TLAQRTVLARG"
     MSDSMVRGMD IGIFTGITDE QIRPALLARA VEERGFESLF VAEHTHIPVR RETPYPEGGD        60
     LPRDYYRTLD PFISLTTAAA VTTRLRLGTA IALVVQRDPI LLAKETATLD LVSDGRFELG       120
     IGAGWLREEM RNHGTDPETR VPLMRERLAA TKALWTSEQA EFHGRFVDFD PIFQWPKPVQ       180
     RPHPPVWIGG WGPTTFHRIV TDGDGWLAPP IPVDALARGV EELAEVANRA GTAAPPVTAI       240
     LLNPDEAATE KAALLGVRRI LFGLFPVTDA DTTLRTLDHL GTLAQRTVLA RG               292
//

If you have problems or comments...

PBIL Back to PBIL home page