(data stored in ACNUC7421 zone)

EMBL: CP000820.PE483

CP000820.PE483       Location/Qualifiers
FT   CDS             complement(572363..573112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0490"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   rha:RHA1_ro01555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09952"
FT                   /db_xref="GOA:A8KX49"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX49"
FT                   /protein_id="ABW09952.1"
FT                   /translation="MRDWLVGLGIAAGCLVASWGVLFLLARRLPPGVLRDLAAFIPDCL
FT                   TTVRRLRKNPQVPRKAKIAVLIAGLWVASPIDLIPEFLPVIGPLDDIVVVALALRYAGR
FT                   QVPRDVLLAAWPGQPRLLERLLGPAHTSPPDSADAAAGNGPTEVELLVTPDCPHQGPAA
FT                   VLLRQALNDIGLTSTRITTTAVTDQRHAEELGFAGSPTIRIAGRDLFAQPSHAPTLACR
FT                   IYHTPTGLAATPDLSELRQALRRASGR"
     MRDWLVGLGI AAGCLVASWG VLFLLARRLP PGVLRDLAAF IPDCLTTVRR LRKNPQVPRK        60
     AKIAVLIAGL WVASPIDLIP EFLPVIGPLD DIVVVALALR YAGRQVPRDV LLAAWPGQPR       120
     LLERLLGPAH TSPPDSADAA AGNGPTEVEL LVTPDCPHQG PAAVLLRQAL NDIGLTSTRI       180
     TTTAVTDQRH AEELGFAGSP TIRIAGRDLF AQPSHAPTLA CRIYHTPTGL AATPDLSELR       240
     QALRRASGR                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page