(data stored in ACNUC7421 zone)

EMBL: CP000820.PE484

CP000820.PE484       Location/Qualifiers
FT   CDS             complement(573105..573734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_5569 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09953"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX50"
FT                   /protein_id="ABW09953.1"
FT                   /translation="MGQQPLRQQVHVTRVTLIVVSNDPTSRWLVVSVRLPGDPSRHRVA
FT                   VWRELRRLGAMPVGSGVWAMPATPLFLDGLDRVRALVDRGNGRVVALDGRARDGNSEAT
FT                   LVAEFNAARAAEWAEFVAECDKFDAEIAKERRIGKFTLAELDEEEQSLERLRRWWRELK
FT                   TRDVFAAVANTPAGERLEHCVKVLDAYSEDVYRAVHAPLDEETDHA"
     MGQQPLRQQV HVTRVTLIVV SNDPTSRWLV VSVRLPGDPS RHRVAVWREL RRLGAMPVGS        60
     GVWAMPATPL FLDGLDRVRA LVDRGNGRVV ALDGRARDGN SEATLVAEFN AARAAEWAEF       120
     VAECDKFDAE IAKERRIGKF TLAELDEEEQ SLERLRRWWR ELKTRDVFAA VANTPAGERL       180
     EHCVKVLDAY SEDVYRAVHA PLDEETDHA                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page