(data stored in ACNUC7421 zone)

EMBL: CP000820.PE486

CP000820.PE486       Location/Qualifiers
FT   CDS             574870..576030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0494"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; KEGG:
FT                   stp:Strop_3570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09955"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX52"
FT                   /protein_id="ABW09955.1"
FT                   /translation="MERRTFLRSAIAGTGVVAFSGAIWDTALAAPAQNGSSPYGSLLAA
FT                   DANGVMLPSGFTSRIVARSGQVVSGTSYTWHNAPDGGAVFLNGTGWMYVSNSEVGSSAG
FT                   GASVLRFDSSGTVTSAQRILSNTSSNCAGGATPWGTWLSCEETSNGRVWETYPATGASA
FT                   VSRPAMGRFKHEAAACDPVRQVIYLTEDQTDGCFYRFRPTTWGNLSSGTLEVLVAGSGT
FT                   SGTATWQVVPDPDGSPTATRSQVSGAKHFNGGEGCHYANNTVWFTTKGDNRVWEVHVDT
FT                   NTFELAYDDSLVSPGPAPLTGVDNITGSTYGDLYVAEDGGNLEICIITPDDIVAPILRL
FT                   VGHNSSEITGPAFSPNGQRLYFSSQRGTSGSSSGGITFEVTGPFRT"
     MERRTFLRSA IAGTGVVAFS GAIWDTALAA PAQNGSSPYG SLLAADANGV MLPSGFTSRI        60
     VARSGQVVSG TSYTWHNAPD GGAVFLNGTG WMYVSNSEVG SSAGGASVLR FDSSGTVTSA       120
     QRILSNTSSN CAGGATPWGT WLSCEETSNG RVWETYPATG ASAVSRPAMG RFKHEAAACD       180
     PVRQVIYLTE DQTDGCFYRF RPTTWGNLSS GTLEVLVAGS GTSGTATWQV VPDPDGSPTA       240
     TRSQVSGAKH FNGGEGCHYA NNTVWFTTKG DNRVWEVHVD TNTFELAYDD SLVSPGPAPL       300
     TGVDNITGST YGDLYVAEDG GNLEICIITP DDIVAPILRL VGHNSSEITG PAFSPNGQRL       360
     YFSSQRGTSG SSSGGITFEV TGPFRT                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page