(data stored in ACNUC7421 zone)

EMBL: CP000820.PE488

CP000820.PE488       Location/Qualifiers
FT   CDS             complement(576808..577452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09957"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX54"
FT                   /protein_id="ABW09957.1"
FT                   /translation="MDDPGHGGSADLPRLLSAVGWLGLVARSSAAKDAEILVLRHELAV
FT                   LHRQVARPRFCWADRAILAGLARLLPQASRSILLVRPETILRWHRQLVRRRWTQPHRPP
FT                   GRPSTPTEIRHLILHLAKENPHWGYRRIHGELIRLGYSVGASTVWTILRSAQVNPAPRH
FT                   TSPTWRQFLHIQAHGILACDFFTINRPAEQAVRPVLPRAGLPPQSPSRPAI"
     MDDPGHGGSA DLPRLLSAVG WLGLVARSSA AKDAEILVLR HELAVLHRQV ARPRFCWADR        60
     AILAGLARLL PQASRSILLV RPETILRWHR QLVRRRWTQP HRPPGRPSTP TEIRHLILHL       120
     AKENPHWGYR RIHGELIRLG YSVGASTVWT ILRSAQVNPA PRHTSPTWRQ FLHIQAHGIL       180
     ACDFFTINRP AEQAVRPVLP RAGLPPQSPS RPAI                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page