(data stored in ACNUC7421 zone)

EMBL: CP000820.PE489

CP000820.PE489       Location/Qualifiers
FT   CDS             complement(578590..579471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09958"
FT                   /db_xref="GOA:A8KX55"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX55"
FT                   /protein_id="ABW09958.1"
FT                   /translation="MSTHRPRRIGRGEAERMLRGGPVNDGVGADPLADLLAAVAAPARD
FT                   GELDGEEAAVAAFREARLTHVTQPRRKPMIKMMFAKLLTVKVAALAAGATAIGGVAVAA
FT                   STGVLPIAGGGDSAAVSPTASPSAEVSVPAIHVPSAGASVSVSLLGLCHTYTAAAATDA
FT                   RTTLDSPNMRALVTAAGSPDKVDAFCAKALQAEIDAAATPGTTPGASASAGPDGNGVGA
FT                   QVPGAGAGVGASAGPDGAGLGVHVGPSAGVGASARPGGAGVGAQVPSAGVGANVGQGGA
FT                   GLGASAAPSVHR"
     MSTHRPRRIG RGEAERMLRG GPVNDGVGAD PLADLLAAVA APARDGELDG EEAAVAAFRE        60
     ARLTHVTQPR RKPMIKMMFA KLLTVKVAAL AAGATAIGGV AVAASTGVLP IAGGGDSAAV       120
     SPTASPSAEV SVPAIHVPSA GASVSVSLLG LCHTYTAAAA TDARTTLDSP NMRALVTAAG       180
     SPDKVDAFCA KALQAEIDAA ATPGTTPGAS ASAGPDGNGV GAQVPGAGAG VGASAGPDGA       240
     GLGVHVGPSA GVGASARPGG AGVGAQVPSA GVGANVGQGG AGLGASAAPS VHR              293
//

If you have problems or comments...

PBIL Back to PBIL home page