(data stored in ACNUC7421 zone)

EMBL: CP000820.PE49

CP000820.PE49        Location/Qualifiers
FT   CDS             complement(63167..63649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09518"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB57"
FT                   /protein_id="ABW09518.1"
FT                   /translation="MWPPPAASDHQKRSYVTDLSRQDTPVRECGHRGVLGCTGMSRRPV
FT                   LSDAQAPLFRQSGRRRVTGGQDGSSAAARIRLVLHSHRPLTRIGTRLMYDGGDYELVWP
FT                   RHLFVHEASNLLNHRRIHRDWDDRCVLLLDHAFAGPTPQDDFRQAAAQSPPPRGLS"
     MWPPPAASDH QKRSYVTDLS RQDTPVRECG HRGVLGCTGM SRRPVLSDAQ APLFRQSGRR        60
     RVTGGQDGSS AAARIRLVLH SHRPLTRIGT RLMYDGGDYE LVWPRHLFVH EASNLLNHRR       120
     IHRDWDDRCV LLLDHAFAGP TPQDDFRQAA AQSPPPRGLS                             160
//

If you have problems or comments...

PBIL Back to PBIL home page