(data stored in ACNUC7421 zone)

EMBL: CP000820.PE490

CP000820.PE490       Location/Qualifiers
FT   CDS             complement(579529..580140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0498"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: fal:FRAAL0432 putative RNA
FT                   polymerase ECF-subfamily sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09959"
FT                   /db_xref="GOA:A8KX56"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX56"
FT                   /protein_id="ABW09959.1"
FT                   /translation="MIEELDLSSAVIEAQCGDEVAFRLIYRMIQPGLLRYLRVLVGDDA
FT                   EDVASEAWLQIARDLASFRGDFDGFRGWAATIARHRALDHLRRRTRRQRDDIPVEMVTT
FT                   ELAAPDDTAGGALEAMSTEAAMRLIAGLPLDQAEAVLLRVVMGLDAKTAGRVLGKRAGA
FT                   VRTAAHRGLRRLAAQLAEQGITEAGRPEAGEHDRGDSTRR"
     MIEELDLSSA VIEAQCGDEV AFRLIYRMIQ PGLLRYLRVL VGDDAEDVAS EAWLQIARDL        60
     ASFRGDFDGF RGWAATIARH RALDHLRRRT RRQRDDIPVE MVTTELAAPD DTAGGALEAM       120
     STEAAMRLIA GLPLDQAEAV LLRVVMGLDA KTAGRVLGKR AGAVRTAAHR GLRRLAAQLA       180
     EQGITEAGRP EAGEHDRGDS TRR                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page