(data stored in ACNUC7421 zone)

EMBL: CP000820.PE492

CP000820.PE492       Location/Qualifiers
FT   CDS             581191..581571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO0820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09961"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX58"
FT                   /protein_id="ABW09961.1"
FT                   /translation="MTTITVRNLDRSDERRDFPHGHIDVLAVGGHRLDRAVFEPGWRWS
FT                   ESVKPIAGTDLCEFDHFGYVASGRMHLEMADGTGADIGPGDVVACPPGHDAWVLGDEPC
FT                   VFVEMAEPVASDYARAPGTGQP"
     MTTITVRNLD RSDERRDFPH GHIDVLAVGG HRLDRAVFEP GWRWSESVKP IAGTDLCEFD        60
     HFGYVASGRM HLEMADGTGA DIGPGDVVAC PPGHDAWVLG DEPCVFVEMA EPVASDYARA       120
     PGTGQP                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page