(data stored in ACNUC7421 zone)

EMBL: CP000820.PE493

CP000820.PE493       Location/Qualifiers
FT   CDS             582101..582856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cmi:CMM_2033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09962"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX59"
FT                   /protein_id="ABW09962.1"
FT                   /translation="MGASAPPASPTEFRRPTARNRLVGLLAWLAATIAVAAVTARLAAP
FT                   DIASTGAAGLTSDIAETTLADRATVVLAQRRIEPVLSLDGRVVPSDPASDGGFDIVAPV
FT                   RPEDVAYRLIDPPRRIRAAVVGGPSGFDCEYQSLAADSGATEAGATAAAGTSVRCRIPA
FT                   SIRVVPGLSATIGIAWSEPRVTSVLPLTAVLGAAQQGQVVVVDAAGSHTSVRTVALGAS
FT                   DATWIEVSSGLAAGERVLARPVQSDLADD"
     MGASAPPASP TEFRRPTARN RLVGLLAWLA ATIAVAAVTA RLAAPDIAST GAAGLTSDIA        60
     ETTLADRATV VLAQRRIEPV LSLDGRVVPS DPASDGGFDI VAPVRPEDVA YRLIDPPRRI       120
     RAAVVGGPSG FDCEYQSLAA DSGATEAGAT AAAGTSVRCR IPASIRVVPG LSATIGIAWS       180
     EPRVTSVLPL TAVLGAAQQG QVVVVDAAGS HTSVRTVALG ASDATWIEVS SGLAAGERVL       240
     ARPVQSDLAD D                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page