(data stored in ACNUC7421 zone)

EMBL: CP000820.PE495

CP000820.PE495       Location/Qualifiers
FT   CDS             583538..585370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0503"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cmi:CMM_2031 putative ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09964"
FT                   /db_xref="GOA:A8KX61"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX61"
FT                   /protein_id="ABW09964.1"
FT                   /translation="MRRRHTTAGARNGMLPIFGLGIAAWYDVRTRPLRTLAAVAGMIAA
FT                   VGALMVVDAAGVLSRHGADDYLRRQYGQPATFLISGTGSSDARRQTEADTLLTQGLDQA
FT                   GFRTISPYQLVRGITLDGDHSAAVDTAVVDGSYPDVRVIDLVAGDFPTRAADRGVPRAV
FT                   LEEGIARQLGWEPHQIVGRQLQYAVTGTAATIDTRNPRTMTVVVDAVMASTARGDSVPR
FT                   LLLVGRLPPQLHSAAEDTPGRWLARVAPADTAYFQEVVASTGRRLGSGSGFEATRLDQD
FT                   EALAPVIDQQTRTAGIVAWVAMAVGGLGMLGVGVASVRERARELGVRRALGASRATIFL
FT                   GVLVETMFNVLVAAALAVPLAALIVHLLPLPVQHGHRHIALRRRPARIGHRSAPGPLER
FT                   HHPAGRQHRRRRPSHPCLHARSRRDGGRSPRHRAGSCRPPGPDRGPERTRAGRVVAEPE
FT                   PLGHRRGGLAAHGDGAAPSVHQRACRLADHPGARRCGRCRYLYRTTVVLPAGWDTGVGA
FT                   VLLELGQVAGTMRVSVNGRSAGDDCVATRALDVRPLLRDGANHVEMEIATTLGNRLIGL
FT                   GKAGEEAYARFAKRSPRPAGLIGPVSLSGIAATT"
     MRRRHTTAGA RNGMLPIFGL GIAAWYDVRT RPLRTLAAVA GMIAAVGALM VVDAAGVLSR        60
     HGADDYLRRQ YGQPATFLIS GTGSSDARRQ TEADTLLTQG LDQAGFRTIS PYQLVRGITL       120
     DGDHSAAVDT AVVDGSYPDV RVIDLVAGDF PTRAADRGVP RAVLEEGIAR QLGWEPHQIV       180
     GRQLQYAVTG TAATIDTRNP RTMTVVVDAV MASTARGDSV PRLLLVGRLP PQLHSAAEDT       240
     PGRWLARVAP ADTAYFQEVV ASTGRRLGSG SGFEATRLDQ DEALAPVIDQ QTRTAGIVAW       300
     VAMAVGGLGM LGVGVASVRE RARELGVRRA LGASRATIFL GVLVETMFNV LVAAALAVPL       360
     AALIVHLLPL PVQHGHRHIA LRRRPARIGH RSAPGPLERH HPAGRQHRRR RPSHPCLHAR       420
     SRRDGGRSPR HRAGSCRPPG PDRGPERTRA GRVVAEPEPL GHRRGGLAAH GDGAAPSVHQ       480
     RACRLADHPG ARRCGRCRYL YRTTVVLPAG WDTGVGAVLL ELGQVAGTMR VSVNGRSAGD       540
     DCVATRALDV RPLLRDGANH VEMEIATTLG NRLIGLGKAG EEAYARFAKR SPRPAGLIGP       600
     VSLSGIAATT                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page