(data stored in ACNUC7421 zone)

EMBL: CP000820.PE496

CP000820.PE496       Location/Qualifiers
FT   CDS             complement(585420..585989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0504"
FT                   /product="zinc finger SWIM domain protein"
FT                   /note="PFAM: zinc finger SWIM domain protein; KEGG:
FT                   sen:SACE_3089 SWIM zinc finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09965"
FT                   /db_xref="GOA:A8KX62"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX62"
FT                   /protein_id="ABW09965.1"
FT                   /translation="MMPPEFGATPWGRAWVRTVESTSTAGPNAQLPKARTLARNSTTVV
FT                   AAGAGHVEADVTVSGEVCRVRLDLPVWSDETQAEAGRLVAKAMAEHRGMVAGDLPDTLE
FT                   EDLRDHAINIAVPLEEQPGSCSCRARKRPCVHILAVIYALAQLVDERPALAVELRSATA
FT                   NAAGAGAGAVDWIALSELEPAGFYGD"
     MMPPEFGATP WGRAWVRTVE STSTAGPNAQ LPKARTLARN STTVVAAGAG HVEADVTVSG        60
     EVCRVRLDLP VWSDETQAEA GRLVAKAMAE HRGMVAGDLP DTLEEDLRDH AINIAVPLEE       120
     QPGSCSCRAR KRPCVHILAV IYALAQLVDE RPALAVELRS ATANAAGAGA GAVDWIALSE       180
     LEPAGFYGD                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page