(data stored in ACNUC7421 zone)

EMBL: CP000820.PE497

CP000820.PE497       Location/Qualifiers
FT   CDS             complement(585986..587839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0505"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: sen:SACE_3090 SNF2/RAD54 family helicase;
FT                   PFAM: SNF2-related protein; helicase domain protein; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09966"
FT                   /db_xref="GOA:A8KX63"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX63"
FT                   /protein_id="ABW09966.1"
FT                   /translation="MTELPGRLQATFVPAEDAIAWWGVVGLDDAVREHGLPEGRAGVCR
FT                   LAVAGRGGVRSASVPVRFADLDAARQGLLMLDPRAEVGASVRAWRDAVRLLDGDDEEFG
FT                   RLGARMPPAAHAVLNAEGTAITTASTLLAQFRQTLATRAALRGAVVTAELRPYQVHGVA
FT                   WLSARPGLGYGGVLADEMGLGKTLQAICMLATCRSDMPHLVVCPTSLIGNWRRELARFA
FT                   PTTPVISYHGAARKLPETFQPGTVVVTSYPVLRKDEPLAATAWGVVILDEAQQIKNPEA
FT                   LASRAAAQLSATVRIAMTGTPVENRLEELWSILNVSNPGLLGTRGRFRQRFVVPIEQRR
FT                   SATAAAALNRMVRPHLLRRTKAEVAADLPPKQYSTIVCTMADEQARLYREAVDRAFTEG
FT                   LGAGIERSGRVLALLTALKQICNHPAQYLREDTATPGRSGKFDRATEMLSEVVEQDDRV
FT                   LVFTQYRAMGKLLSRYLGTALGVGLVPFLHGGLSMQRRDELVHAFQEDDDAPPVLLLSL
FT                   RAAGFGLNLTRASHVMHYDRWWNPAVEEQATDRAHRIGQSRTLNVYTLVTGGTIEDHIA
FT                   QMHENKRGVAEIVSGDTQAALAKLSDDDLHAVLALDEGTFA"
     MTELPGRLQA TFVPAEDAIA WWGVVGLDDA VREHGLPEGR AGVCRLAVAG RGGVRSASVP        60
     VRFADLDAAR QGLLMLDPRA EVGASVRAWR DAVRLLDGDD EEFGRLGARM PPAAHAVLNA       120
     EGTAITTAST LLAQFRQTLA TRAALRGAVV TAELRPYQVH GVAWLSARPG LGYGGVLADE       180
     MGLGKTLQAI CMLATCRSDM PHLVVCPTSL IGNWRRELAR FAPTTPVISY HGAARKLPET       240
     FQPGTVVVTS YPVLRKDEPL AATAWGVVIL DEAQQIKNPE ALASRAAAQL SATVRIAMTG       300
     TPVENRLEEL WSILNVSNPG LLGTRGRFRQ RFVVPIEQRR SATAAAALNR MVRPHLLRRT       360
     KAEVAADLPP KQYSTIVCTM ADEQARLYRE AVDRAFTEGL GAGIERSGRV LALLTALKQI       420
     CNHPAQYLRE DTATPGRSGK FDRATEMLSE VVEQDDRVLV FTQYRAMGKL LSRYLGTALG       480
     VGLVPFLHGG LSMQRRDELV HAFQEDDDAP PVLLLSLRAA GFGLNLTRAS HVMHYDRWWN       540
     PAVEEQATDR AHRIGQSRTL NVYTLVTGGT IEDHIAQMHE NKRGVAEIVS GDTQAALAKL       600
     SDDDLHAVLA LDEGTFA                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page