(data stored in ACNUC7421 zone)

EMBL: CP000820.PE498

CP000820.PE498       Location/Qualifiers
FT   CDS             complement(588041..588454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09967"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX64"
FT                   /protein_id="ABW09967.1"
FT                   /translation="MSCSVLAGVRRAADEAHANEAFGLRRPMRRPDCQASGIRPAPDVL
FT                   LALGCRPGVPSLPEPCALLGLTHAARYTTLGGAPANRKRALETKRRRLSSSWAMCISAA
FT                   APRWLFDMGGRSQTRLESGLVNGSRAAQALVMS"
     MSCSVLAGVR RAADEAHANE AFGLRRPMRR PDCQASGIRP APDVLLALGC RPGVPSLPEP        60
     CALLGLTHAA RYTTLGGAPA NRKRALETKR RRLSSSWAMC ISAAAPRWLF DMGGRSQTRL       120
     ESGLVNGSRA AQALVMS                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page