(data stored in ACNUC7421 zone)

EMBL: CP000820.PE500

CP000820.PE500       Location/Qualifiers
FT   CDS             complement(589386..591407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0508"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: fal:FRAAL2289 putative two-component sensor
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: GAF domain
FT                   protein; histidine kinase dimerisation and phosphoacceptor
FT                   region; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09969"
FT                   /db_xref="GOA:A8KX66"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX66"
FT                   /protein_id="ABW09969.1"
FT                   /translation="MTSVSGDARHVGAGSWAGEHVGDVEAAVLLDTLSEVVFRTDAEGR
FT                   WTYLNRAWTRLTGFEIGPSLGARFLDYVHPDELEYTVALFMGVVAGGADHCHHETRYRT
FT                   RDGSYRRVQIRANVIRDGDGEVIGNTGTIVDVTDSRRGSETIGEHVALLELVSADAPGG
FT                   ELPVGVVVYDADLRLRRGSPVIDRLAGAPQRIGDPLARLVERLAPADPRQRALGGEWGL
FT                   IAVARRTNHAQVSDLDLADPSRSLRVSVIPYLRDGEEMLALVLADITDLRRAEHRQAAL
FT                   ARLGHRAISSSDTAALVSEAAGMVTSTLDVAGCKLIHLDPRGGDAAGTSPLLDRVLTDD
FT                   QPVMIDSPVSDLARCLAGSPPGSDVATVLATRVGGAGLLFGVLAAHSTTPRHFTDDEIQ
FT                   FVQAVADILTAALERDRTDHELRRLYRRAEHSKAWLAASAHTITRVIAATEPRDALDLI
FT                   AATARTMAGTDIGVVAVPDEHGNLVITTADVAPGLPAAPDSLLGLSLTQGVTPVAEQLT
FT                   AGGTVVLDSLDLRGSRISPAPNMPIATALILPLRITRRSSAVLILGNHTDTARLPLHDI
FT                   ELIEAFAHDAALAVELIQTQHDRARLAVFQDRDRIARDLHDQVIQRLFAIGLHLQSLTR
FT                   AVGDIAAARLTSAINALDHTIDDIRHTIFDLHPIQPGQ"
     MTSVSGDARH VGAGSWAGEH VGDVEAAVLL DTLSEVVFRT DAEGRWTYLN RAWTRLTGFE        60
     IGPSLGARFL DYVHPDELEY TVALFMGVVA GGADHCHHET RYRTRDGSYR RVQIRANVIR       120
     DGDGEVIGNT GTIVDVTDSR RGSETIGEHV ALLELVSADA PGGELPVGVV VYDADLRLRR       180
     GSPVIDRLAG APQRIGDPLA RLVERLAPAD PRQRALGGEW GLIAVARRTN HAQVSDLDLA       240
     DPSRSLRVSV IPYLRDGEEM LALVLADITD LRRAEHRQAA LARLGHRAIS SSDTAALVSE       300
     AAGMVTSTLD VAGCKLIHLD PRGGDAAGTS PLLDRVLTDD QPVMIDSPVS DLARCLAGSP       360
     PGSDVATVLA TRVGGAGLLF GVLAAHSTTP RHFTDDEIQF VQAVADILTA ALERDRTDHE       420
     LRRLYRRAEH SKAWLAASAH TITRVIAATE PRDALDLIAA TARTMAGTDI GVVAVPDEHG       480
     NLVITTADVA PGLPAAPDSL LGLSLTQGVT PVAEQLTAGG TVVLDSLDLR GSRISPAPNM       540
     PIATALILPL RITRRSSAVL ILGNHTDTAR LPLHDIELIE AFAHDAALAV ELIQTQHDRA       600
     RLAVFQDRDR IARDLHDQVI QRLFAIGLHL QSLTRAVGDI AAARLTSAIN ALDHTIDDIR       660
     HTIFDLHPIQ PGQ                                                          673
//

If you have problems or comments...

PBIL Back to PBIL home page