(data stored in ACNUC7421 zone)

EMBL: CP000820.PE502

CP000820.PE502       Location/Qualifiers
FT   CDS             593665..597030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0510"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   KEGG: fal:FRAAL4612 hypothetical protein; putative membrane
FT                   protein; putative GGDEF and EAL domains"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09971"
FT                   /db_xref="GOA:A8KX68"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX68"
FT                   /protein_id="ABW09971.1"
FT                   /translation="MLLVGGFWCRWAGSLFWRVTSGDDWRWIGRRPRVRGWVPAQGGPV
FT                   VEPGCRGVLSAASTFSWSVCAVRSEVVQGPKPGSRDGTDCSAERRRLRSADGGAEVKGR
FT                   GASTGGREFFCVLSLLSTGFLLLLAMVPGSPGYLRPTVVVAVGLGVVTVAAVLAVPASR
FT                   RREMALVSSAMMTTAVTIALVGAERDALALSLLFWFPWAGSYAGLVWRRFGAVMGQAAL
FT                   VAAVGLGAFSAHGRLAAFPFVGVGCALSVLACAYVTYGSLQRGRGPCFSDSVTDLTNRA
FT                   GLLQAGDPVLSEIMLAGRQALLMIVNIDHFREINTALGYEAGDEVLRMFARRLRSVRPA
FT                   PSCVGRLGGDEFALVMPGASQVADGVPAPERTDSAPADVGRAVLDQLDGRLRISGVDVE
FT                   VEATAGLAVAPWCGDRIATLLPCADAALSDARRGGERVGVWRAEMVGVQPWELALHAQL
FT                   RSAITRGELVLHYQPMQEAATGRIVDVEALLRWRHPDRGLLPPGSFLPMAERSSLIVDL
FT                   TWWELDEALRQCARWRTEGLRMPVSANLSARMLVVDELPRVVAERLAAHDLPADMLTLE
FT                   ITESALISQPARAAAMLSELRITGVKLSMDDFGTGYNSMEILKALPFDEVKIDRGFVSD
FT                   ARRSLPDAAIVRSVIDLGHRLGMRVVGEGVEDEHSERMLTELGCDLLQGEALSPPLPAR
FT                   KLPPLLASKPRVTSRSRAPAPTSTPTRAAGLPQKTPPGALQGQESAIVGEHSGEQAAAQ
FT                   VGETGIEQPAFAEATTQAKAHWTRSGLSAAVPADEEARLAALRGHHVLDTPPEPEFDAL
FT                   ATLAAQIADCTYAHVVFVDAGREWFKSCHGLRITELGARVGVASHTVASGTYLEVPDAT
FT                   RDLRFARVVRSDPNLPVRFFAGVPLRTPEGHVLGALCVSDRLPRRLAPGQRHALHQLAT
FT                   QTMRLLDARRERQTTEEITTALHTLDQLWYPDDLPTAATLTADIIRSLAGADAVAVMLA
FT                   EMPGSTVFHAAGSSVAPGTEPLLRVGIRATPDDEAALRALSHLKDAIFIPDPERTPLIP
FT                   TEMVRKLNIRSALVIPLPGEGGLLGLITVRWTHPLTCVEPSLLQAITLFATSARYTLHR
FT                   LQAACRRRGEWPPA"
     MLLVGGFWCR WAGSLFWRVT SGDDWRWIGR RPRVRGWVPA QGGPVVEPGC RGVLSAASTF        60
     SWSVCAVRSE VVQGPKPGSR DGTDCSAERR RLRSADGGAE VKGRGASTGG REFFCVLSLL       120
     STGFLLLLAM VPGSPGYLRP TVVVAVGLGV VTVAAVLAVP ASRRREMALV SSAMMTTAVT       180
     IALVGAERDA LALSLLFWFP WAGSYAGLVW RRFGAVMGQA ALVAAVGLGA FSAHGRLAAF       240
     PFVGVGCALS VLACAYVTYG SLQRGRGPCF SDSVTDLTNR AGLLQAGDPV LSEIMLAGRQ       300
     ALLMIVNIDH FREINTALGY EAGDEVLRMF ARRLRSVRPA PSCVGRLGGD EFALVMPGAS       360
     QVADGVPAPE RTDSAPADVG RAVLDQLDGR LRISGVDVEV EATAGLAVAP WCGDRIATLL       420
     PCADAALSDA RRGGERVGVW RAEMVGVQPW ELALHAQLRS AITRGELVLH YQPMQEAATG       480
     RIVDVEALLR WRHPDRGLLP PGSFLPMAER SSLIVDLTWW ELDEALRQCA RWRTEGLRMP       540
     VSANLSARML VVDELPRVVA ERLAAHDLPA DMLTLEITES ALISQPARAA AMLSELRITG       600
     VKLSMDDFGT GYNSMEILKA LPFDEVKIDR GFVSDARRSL PDAAIVRSVI DLGHRLGMRV       660
     VGEGVEDEHS ERMLTELGCD LLQGEALSPP LPARKLPPLL ASKPRVTSRS RAPAPTSTPT       720
     RAAGLPQKTP PGALQGQESA IVGEHSGEQA AAQVGETGIE QPAFAEATTQ AKAHWTRSGL       780
     SAAVPADEEA RLAALRGHHV LDTPPEPEFD ALATLAAQIA DCTYAHVVFV DAGREWFKSC       840
     HGLRITELGA RVGVASHTVA SGTYLEVPDA TRDLRFARVV RSDPNLPVRF FAGVPLRTPE       900
     GHVLGALCVS DRLPRRLAPG QRHALHQLAT QTMRLLDARR ERQTTEEITT ALHTLDQLWY       960
     PDDLPTAATL TADIIRSLAG ADAVAVMLAE MPGSTVFHAA GSSVAPGTEP LLRVGIRATP      1020
     DDEAALRALS HLKDAIFIPD PERTPLIPTE MVRKLNIRSA LVIPLPGEGG LLGLITVRWT      1080
     HPLTCVEPSL LQAITLFATS ARYTLHRLQA ACRRRGEWPP A                          1121
//

If you have problems or comments...

PBIL Back to PBIL home page