(data stored in ACNUC7421 zone)

EMBL: CP000820.PE507

CP000820.PE507       Location/Qualifiers
FT   CDS             600407..601156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0515"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: mpa:MAP2184c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09976"
FT                   /db_xref="GOA:A8KX73"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX73"
FT                   /protein_id="ABW09976.1"
FT                   /translation="MAAKLDGKVAIITGAGSGIGRASAHLFAAEGAKVVCADFSGKEKR
FT                   TADEIGAAAVAVHVDVAVAADVERMVATAEDRFGKLDILFNNAGVAGPKMLITEQKEED
FT                   FDRVVAVNLKGVFLGMKYGIPAILRNGGGSLINTASAAGLVGWRKNAVYGASKGGVIQM
FT                   TKAVALDFADRGVRVNAICPGMTWTGMVPGSDDLLEPPASVPAPPQPMSRWGLPSELAT
FT                   AALFLASDDSSFVTGVALPVDGGYVVG"
     MAAKLDGKVA IITGAGSGIG RASAHLFAAE GAKVVCADFS GKEKRTADEI GAAAVAVHVD        60
     VAVAADVERM VATAEDRFGK LDILFNNAGV AGPKMLITEQ KEEDFDRVVA VNLKGVFLGM       120
     KYGIPAILRN GGGSLINTAS AAGLVGWRKN AVYGASKGGV IQMTKAVALD FADRGVRVNA       180
     ICPGMTWTGM VPGSDDLLEP PASVPAPPQP MSRWGLPSEL ATAALFLASD DSSFVTGVAL       240
     PVDGGYVVG                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page